KEGG   Rahnella sp. Y9602: Rahaq_0102Help
Entry
Rahaq_0102        CDS       T01422                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rah  Rahnella sp. Y9602
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rah00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(107367..108380)
Genome map
AA seq 337 aa AA seqDB search
MSLFRRYSLVLWFGLIFAFFSSAVMAQDAGWSAYKSRFLMPDGRIIDTANKNVSHTEGQG
FSMLLAVFNDDQATFDKLWQWANTTLYRKDIGLYSWRYDPNSTPHVADINNASDGDTLMA
WALLLAGDKWNDSRYTKASEKLQTALIKYNVIDYAGYKVMLPGVKGFNQTSNVTVNPSYF
IFPAWQAFYAHSHLKVWKDLDESSTAMLSKMAFGDFRLPTDWVDMQADGTLKPASRWPTR
FSYDAVRIPLYLGWAHPGSPQLAPFILWWQKSPRDATPAWIDVMTGTKAGYNMSPGLLAV
RDFTMANAGAISPNLAPKDDYYSSTLQLLSWWASHKG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttatttcggcgctacagcctggtgctgtggttcggccttattttcgcgtttttc
agttccgctgtaatggctcaggatgctggctggtctgcgtataaaagtcgctttctgatg
ccagatggacgaatcattgataccgccaataaaaacgtcagtcacaccgaaggtcagggt
ttcagtatgctgctcgcggtgttcaatgacgatcaggcgacgttcgacaagctgtggcag
tgggcaaacacgacgctctatcgcaaagatatcggcctgtattcatggcggtatgacccg
aacagcactccgcatgtggcagatatcaacaacgcctctgatggcgatacgctgatggcc
tgggcgctgttgctggcgggtgataagtggaacgacagccgttacaccaaagcctctgaa
aaattgcagacggcgctgatcaaatacaatgtgattgattacgccggttacaaagtgatg
ctgccgggcgtgaagggtttcaatcagaccagcaacgtgaccgtcaatccgtcctatttc
atcttccctgcctggcaggcattttatgcgcacagccatttgaaagtctggaaagatctg
gatgaaagcagcaccgcgatgctcagtaaaatggcgtttggcgatttccgcttaccgacg
gactgggtggatatgcaggccgatggcaccctgaaaccggccagccgctggccaacgcgt
ttcagttacgatgccgtgcgtatcccgctgtatctcggctgggcgcatcccggcagcccg
caactggcaccgtttattctgtggtggcaaaaatccccacgcgacgccacacccgcctgg
attgatgtcatgaccggcaccaaagcgggctacaacatgtcaccgggattattagccgtg
cgcgatttcaccatggccaacgctggcgccatcagcccgaacctggcaccgaaagacgat
tactactcttccaccctgcaactgctgagctggtgggcaagtcataaagggtaa

DBGET integrated database retrieval system