KEGG   Rahnella sp. Y9602: Rahaq_0136Help
Entry
Rahaq_0136        CDS       T01422                                 

Definition
glycoside hydrolase
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
rah  Rahnella sp. Y9602
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rah00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:rah00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(150773..153829)
Genome map
AA seq 1018 aa AA seqDB search
MNNWENIEKQSENRLPPRASFFSYENPQAALRFDRAASHGFQLLSGRWQFRFFEHPALVP
DEFYNQPMTEWGHITVPGMWQMEGHGQLQYTDEGFPFPIDVPYVPTNNPTGAYQQRFTLD
AAWTGKQTLIKFDGVETYFEVYVNGHYVGFSKGSRLCAEFDISASVKPGENLLSVRVLQW
ADSTYIEDQDMWWMAGIFRDVYLIGQDPVHLNDFTVVTTFDENYCDAVLNIDAVLRNLLQ
PVSGYRLHAQLFDDGVCVAQLSADNLNIGDETRCRLDIPVSHPRQWNAEHPELYQLLLTL
YDDTGQMISVVPQRVGFRDIRVRDGLFYVNGRYLKLHGVNRHDHDHRKGRAVDMARVERD
IILMKQHNINAVRTAHYPNDPRFYELCDIYGLFVMAETDLESHGFANVGDLSRISDDPHW
EHAYVERIGRHVMAQKNHPSIIMWSLGNESGYGCNIRAMAKHCKALDPTRLVHYEEDRDA
EVTDVISTMYSRVQMMNAFGEYPHAKPRIICEYAHAMGNGPGGLAEYQAVLNRHDSLQGH
YIWEWCDHGLLETGENGQMRYTYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLREYKQVLC
PVGVSLRGGALHIKNRYWFSSLEDITLSLTVQVAGRGLETREISLPHLQPGEGETLALPE
FPASGQEVFLNVGIRKNSPTVYSEAQHPLGQYQMLLQAARPSAMKPAPQKSATLLCDEQK
HQLIVSGEGFRLAFSRLDGELQSWQVDDEEITGRAPKLNFFKPVIDNHKQEFEGLWQPHH
LHIMQQHFRQMHWARQQDDVVIEVQSIIAPPVFDFGMRCTYRWQISPQGAVTLDLSGSPY
GNFDSIIPKIGLDFGVSRRFTQVEYYGRGPDENYQDSCQANLIGHYQQPVSRLFENYPMP
QDNGNRQDMRWLSLCDDAGKGIFIQPRQPLNFSLWPYSAQMLQQAQHIDELTPDGCLTLN
LDHKISGLGSNSWGSEVLDSYRVYFSAFRYGFTMVPFSQHDTNSQQLAEFTFHPAEEN
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
gtgaataattgggaaaatatcgagaagcagtcggagaaccgtttaccgccacgcgcctcc
tttttcagctatgaaaatccacaggcggcgctgcgtttcgatcgcgcagccagtcacggc
tttcagttgctcagcggccgctggcagttccgctttttcgagcacccggcgttagtcccg
gatgaattctacaatcagccgatgactgaatggggccacatcaccgtccccggcatgtgg
cagatggaaggccacggccagctgcaatataccgatgaaggtttccccttcccgatcgac
gttccttacgttcccactaataacccgaccggcgcctatcagcagcgttttaccctcgat
gcagcctggacaggcaaacaaacgctgatcaaatttgacggcgtggaaacctatttcgag
gtgtatgtgaacgggcactacgtcggattcagcaaaggcagccgcctgtgcgcagagttc
gatatcagcgccagcgtgaaaccgggtgaaaacctgctgtcggtgcgtgttttacagtgg
gcggattcaacatatatcgaagatcaggatatgtggtggatggcgggaattttccgcgat
gtgtatctcatcggtcaggatccggttcatcttaacgatttcaccgtagtcaccacattc
gatgaaaactactgcgacgccgtgctcaatattgatgccgtgctgcgtaatttactccaa
cccgtcagcggttatcgtctgcacgcgcagttattcgacgatggcgtctgcgtggcacag
ttatcagcagataacctgaatatcggcgatgaaacgcgctgtcgcctggacattccggtc
agtcatccgcgccagtggaacgcggaacatcctgagttatatcagctgttgctgacgctg
tatgacgacacgggacagatgatttcggtggtacctcagcgcgttggctttcgtgacatc
cgcgtacgcgacgggctgttttacgtcaacggacgttatctcaagctgcacggcgtaaac
cgccacgaccacgatcaccgcaaagggcgtgcggtcgatatggcgcgggtggaacgcgat
atcatcctgatgaaacagcacaatattaacgcggtgcgcaccgcgcattacccgaatgat
cctcgcttttacgagttgtgcgatatctacggattattcgtgatggccgaaacggatctg
gaaagtcacggtttcgcgaacgtcggcgatctgagccgcatctccgacgatccgcactgg
gaacacgcctatgtggagcgtatcgggcgtcacgtcatggcgcaaaaaaaccacccgtcg
atcattatgtggtcgcttggcaacgaatccggttatggctgcaatatccgcgccatggcg
aaacactgtaaagccctcgatccgacgcgtcttgttcactacgaagaagatcgcgacgcc
gaagtgaccgacgtcatcagcaccatgtattcccgcgtacagatgatgaatgcgttcggc
gaatacccgcacgccaaaccgcgcatcatctgcgaatacgcgcatgcaatgggcaacggt
cccggcggattagccgaatatcaggccgttctgaatcgccatgacagccttcaggggcat
tacatctgggaatggtgcgatcacggattgctggaaaccggtgaaaacggccagatgcgt
tatacctacggcggcgattacggcgattatccaaacaactacaacttctgcatggacggg
ctgatttaccccgaccagacgcccggccccggcctgcgcgaatataaacaggtgctgtgc
ccggtcggcgtcagtctccgcggcggcgcgctgcacatcaaaaatcgttactggttcagc
tcactggaagacatcacgctgtcgctgaccgttcaggtcgccggacgcggcctcgaaacc
cgcgaaatttccctgccgcacctgcaacccggcgaaggcgaaacgctggcgctgccagaa
tttcccgccagcggtcaggaagttttcctgaatgttggcattcgcaaaaacagcccgacg
gtgtacagcgaagcgcaacatccgctcggacagtatcagatgctgttgcaggcagcccgc
ccgtcagccatgaaacctgcgccgcaaaagtccgcaacgctgttatgtgatgagcaaaaa
catcagcttatcgtcagcggcgagggcttccggctggcattttcccgtctggacggcgaa
ctgcaaagctggcaagtggatgacgaagagatcacaggccgtgcgccgaaactcaatttc
tttaagccggtcatcgacaaccataaacaggagttcgaaggcctctggcagccccatcat
ctgcatatcatgcaacagcatttccggcagatgcactgggcgcgccagcaggacgacgtc
gtcattgaagtgcaaagcatcattgcgccgcctgttttcgatttcggtatgcgctgcact
tatcgctggcagatatcgcctcagggcgccgtcaccctcgatttatccggctcgccttac
ggtaatttcgattcaattatcccgaagatcggcctcgattttggcgtcagccgtcgtttc
acgcaggtggaatattacgggcgcgggccggatgaaaactatcaggacagctgtcaggcc
aatctcatcggccattatcagcagccggtgagccgtttatttgaaaattacccgatgccg
caggacaacggtaaccggcaggatatgcgctggctgagtctgtgcgatgacgctggaaaa
gggattttcattcagccacgccagccgctcaatttcagcctgtggccatacagtgcgcag
atgctgcaacaggcgcagcatattgatgaactgacgccggacggctgcctgaccctcaat
ctcgatcacaaaatttccggtctgggctccaattcctggggttccgaagtgctcgattct
tatcgcgtctatttctcggcattccgctacggcttcacgatggtgccgttcagccagcat
gacaccaacagccagcagcttgcggaattcacctttcatcccgcggaggaaaactga

DBGET integrated database retrieval system