KEGG   Rahnella sp. Y9602: Rahaq_0202Help
Entry
Rahaq_0202        CDS       T01422                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00500  Starch and sucrose metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
Module
rah_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rahaq_0202
Enzymes [BR:rah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rahaq_0202
Exosome [BR:rah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rahaq_0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADW71832
JGI: Rahaq_0202
UniProt: A0A0H3F4X9
Position
227669..229852
Genome map
AA seq 727 aa AA seqDB search
MSVLPDQHVINQIISGHYADPFSLLGMHSVAAGLEVRALLPDADQVWVIDVEKGKQVAEL
RRYDDRGFFVGLIPRRKNAFRYKLEVRWGENLHVIDDPYRFGTLLQELDIWLLAEGTHLR
PYEKLGAHLQTLDDVEGVSFAVWAPNATRVSVVGEFNFWDGRRHPMRQRRENGIWELFIP
AVREGQLYKFEIIDCRGHVSLRADPYAFEAQMRPDTASCVRKLPDVVPHSESRKKANALN
QPVSVYEVHLGSWRRHTDDNFWLSYGELAEQLVSYAKWMGFTHIELMPVNEHPFDGSWGY
QPLGMYAPTRRFGTPMEFKAFVDAAHNAGLNVILDWVPGHFPSDTYGLAQFDGTALYEYA
DPREGYHQDWNTLIYNYGRHEVRNYLAGNGFYWIERFGIDGLRVDAVASMIYRDYSRKAG
EWIPNYYGGRENLEAISFLKYTNQTIGRELGGAVTLAEESTDYPGVTMPPDANGLGFHYK
WNMGWMHDSLTYMQLDPVHRKYHHNLMTFGVLYAYSENFILPLSHDEVVHGKKSLLDKMP
GDVWQKFANLRAYYGFMWAHPGKKLLFMGNEFAQGREWNFDASLDWHLLDDPSGWHSGVQ
HLVRDLNQTYQANAPLYELDYNPRGFEWLVVDDHENSIFAFARRDENGGEVIVISNFTPV
PREHYRIGISQPGRYHEILNTDSHFYRGSNVGNGCDIYSENIGHHQRDHSISVTIPPLAT
VYLRREA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacttcccgatcagcacgtcattaaccaaattatatctggccactacgctgat
cctttttctcttttgggtatgcattctgtggccgccgggctggaagtgcgtgccctgttg
ccggatgcggatcaggtctgggttattgatgtagaaaaaggtaaacaggtggcggaactg
cgtcgttacgatgatcgcggtttctttgtcggcctgatcccgcggcgtaaaaatgccttt
cgttacaagctggaagtccgctggggcgagaatctgcatgtgattgacgatccgtaccgg
ttcggcacattgttgcaggaactggatatctggttgctggcagaaggcacgcacctgcgg
ccatacgaaaaactcggcgcacatctgcaaacgctggatgacgtcgagggtgtcagtttt
gccgtctgggcaccgaacgccacgcgggtttccgtcgtgggtgaattcaacttctgggac
ggccgccgacacccgatgcgtcagcgccgtgaaaatggtatctgggaactctttattccc
gccgtccgcgaaggtcaactgtataaattcgaaattatcgactgccgcgggcatgtcagc
ctgcgcgccgacccttatgcttttgaggcgcagatgcgtccggatactgcctcgtgcgtg
cgtaaattaccggatgttgtgccgcattcagaaagccgaaagaaagccaatgcgctgaat
cagccggtttccgtgtatgaagtgcacctgggttcctggcgtcgtcataccgatgataat
ttctggctcagctatggtgaactggccgagcaattagtctcatatgccaaatggatgggt
tttacgcacatcgaactgatgccggtcaacgaacatccgttcgacgggagctggggttat
cagccgcttggcatgtatgcgccgacccgtcgtttcggcacgccgatggaattcaaagcc
tttgttgatgccgcgcataacgccgggctgaacgtcattctcgactgggtgccgggacat
tttccgagcgacacctatggtttagcgcagtttgacggcaccgcgctgtacgaatatgcc
gatccccgtgaaggttatcatcaggactggaacacgctgatttataactatggccgccat
gaagtgcgtaactatctggcaggaaatggtttttactggattgaacggtttggcattgac
ggcctgcgtgtcgatgcggtggcttccatgatttaccgcgattacagccgtaaagccggg
gagtggatcccgaattattacggtggccgcgaaaacctcgaagccatttccttcctgaaa
tacaccaaccagaccattggtcgtgaactcggcggtgcggtgacgctggcggaagaatcg
accgattatcccggcgtcaccatgccgccggatgctaacgggctgggtttccattacaag
tggaatatgggctggatgcacgattccctgacctatatgcagcttgatccggttcaccgc
aaatatcatcacaacctcatgacattcggcgtgctttacgcttacagcgagaacttcata
ttgccgctgtcgcacgacgaagtggtacacggtaaaaaatccttgctggataaaatgccc
ggcgatgtgtggcagaagttcgccaacctgcgcgcctactacggctttatgtgggcacat
ccgggtaagaaactgctgtttatgggcaatgaatttgcgcaggggcgtgagtggaatttt
gacgccagcctcgactggcatctgcttgacgatccaagcggctggcacagcggcgtacaa
catctggtacgcgacctgaaccagacctatcaggccaatgcgccgttgtatgagctcgat
tacaacccgcgcggtttcgaatggctggtggtcgacgatcacgaaaactcgattttcgcc
tttgcccgccgtgacgaaaatggcggtgaagtgatcgtcatcagtaactttacgccggtt
ccgcgtgagcattatcgcataggcatcagtcagcctgggcgttatcacgaaatcctcaat
accgattcgcatttctaccgtggcagtaatgtcggcaacggttgcgatatttacagtgaa
aatattggccatcatcagcgtgaccattcgatcagcgtgactattccgccgctggcgacg
gtttatttgcgaagggaggcgtaa

DBGET integrated database retrieval system