KEGG   Rahnella sp. Y9602: Rahaq_0259Help
Entry
Rahaq_0259        CDS       T01422                                 

Definition
HAD-superfamily hydrolase
Orthology
K07025  
putative hydrolase of the HAD superfamily
Organism
rah  Rahnella sp. Y9602
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(294747..295436)
Genome map
AA seq 229 aa AA seqDB search
MPPDFDWQCIDTVLLDMDGTLLDLAFDSQFWLQDVPLALSQQRAIPLENARQLIHDEYLA
VQHTMNWYCFDYWSERLSLDIYQMTTNIGKNARLRDDTLPFLAHLRESGRQTILLTNAHP
HSLSVKIEHTGLDQHLDLLLSTHTFGYPKEDQRLWSAVQQQTGFNPDRTLFVDDGEPILN
AAKTFGIRYCLGVENPDSTMANKSFEGHPSINDYRSLLPAIHPVTGPAK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgccccccgattttgactggcaatgcatcgatactgttttactggatatggacggcaca
ttgctggatctggcttttgacagccagttctggttgcaggatgtccctcttgcccttagc
cagcagcgtgcgatcccgcttgaaaacgcgcgccagttaattcatgacgaatatctcgcc
gtccagcacaccatgaactggtattgcttcgactactggagtgaaaggctgagtctggat
atctaccagatgacgacgaacatcggcaaaaatgcacgtcttcgcgacgacacgctgccg
tttctggctcatctgcgtgaaagcggacgacagacaattttgctcaccaatgcgcatccg
cacagtctttccgttaaaattgaacataccggattagaccagcaccttgatttattactt
tccacccacacatttggttatccgaaggaagatcagcggctgtggtctgcagttcagcaa
caaacgggctttaatcccgacaggacattatttgtcgatgacggtgaaccgatcctgaat
gcggcaaaaaccttcggcatccgctattgtctgggtgtagaaaatccggactcgaccatg
gcaaataagtcatttgaaggacatccttccatcaatgattaccgcagcctgttgcctgca
attcaccccgtaacaggcccggctaagtaa

DBGET integrated database retrieval system