KEGG   Rahnella sp. Y9602: Rahaq_0259Help
Entry
Rahaq_0259        CDS       T01422                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20881  
5'-nucleotidase [EC:3.1.3.5]
Organism
rah  Rahnella sp. Y9602
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rahaq_0259
   00240 Pyrimidine metabolism
    Rahaq_0259
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rahaq_0259
Enzymes [BR:rah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Rahaq_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(294747..295436)
Genome map
AA seq 229 aa AA seqDB search
MPPDFDWQCIDTVLLDMDGTLLDLAFDSQFWLQDVPLALSQQRAIPLENARQLIHDEYLA
VQHTMNWYCFDYWSERLSLDIYQMTTNIGKNARLRDDTLPFLAHLRESGRQTILLTNAHP
HSLSVKIEHTGLDQHLDLLLSTHTFGYPKEDQRLWSAVQQQTGFNPDRTLFVDDGEPILN
AAKTFGIRYCLGVENPDSTMANKSFEGHPSINDYRSLLPAIHPVTGPAK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgccccccgattttgactggcaatgcatcgatactgttttactggatatggacggcaca
ttgctggatctggcttttgacagccagttctggttgcaggatgtccctcttgcccttagc
cagcagcgtgcgatcccgcttgaaaacgcgcgccagttaattcatgacgaatatctcgcc
gtccagcacaccatgaactggtattgcttcgactactggagtgaaaggctgagtctggat
atctaccagatgacgacgaacatcggcaaaaatgcacgtcttcgcgacgacacgctgccg
tttctggctcatctgcgtgaaagcggacgacagacaattttgctcaccaatgcgcatccg
cacagtctttccgttaaaattgaacataccggattagaccagcaccttgatttattactt
tccacccacacatttggttatccgaaggaagatcagcggctgtggtctgcagttcagcaa
caaacgggctttaatcccgacaggacattatttgtcgatgacggtgaaccgatcctgaat
gcggcaaaaaccttcggcatccgctattgtctgggtgtagaaaatccggactcgaccatg
gcaaataagtcatttgaaggacatccttccatcaatgattaccgcagcctgttgcctgca
attcaccccgtaacaggcccggctaagtaa

DBGET integrated database retrieval system