KEGG   Rahnella sp. Y9602: Rahaq_0448Help
Entry
Rahaq_0448        CDS       T01422                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rah  Rahnella sp. Y9602
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rah00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
481127..481873
Genome map
AA seq 248 aa AA seqDB search
MLEQICQLARDAGDAIMAVYDGEQPLDARHKKDDSPVTAADIAAHNVIKAGLQTLDPQTP
MLSEEDPQSWSERQNWTRYWLVDPLDGTKEFLKRNGEFTVNIALIEDGIPVLGVVYVPVT
KVMYSAAEGKAWKEEQGERQQIAVKEAHPPLVVVSRSHFSNDPELQDYLAQLGEHQTVAI
GSSLKFCLVAEGAAQLYPRFGPTNIWDTGAGHAVALAAGAQVHDWKGQTLNYVPRESFLN
PGFRVSLF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaatttgtcagttagcgcgcgatgcgggtgacgcgatcatggcggtgtat
gacggtgaacaaccgcttgatgcgcgccataaaaaagacgattcgccggtcaccgcagca
gatattgcagcgcacaacgtgattaaagccggcctgcaaacgctggatccgcaaacgccg
atgctgtcggaagaagacccgcaaagctggagcgagcgtcagaactggacgcgttactgg
ctggttgatccgctggacggtaccaaagaattcctgaaacgtaacggtgaattcaccgtt
aatattgcactgatcgaagacggtatcccggtgttaggcgtggtgtacgtgccggtgacc
aaggtgatgtacagcgccgcagaaggcaaagcctggaaagaagagcagggcgaacgtcag
cagattgcagtgaaagaagcgcatccgccgctggtggtcgtcagtcgttcacacttcagt
aatgaccctgaattgcaggattacctggcgcaactgggcgaacatcagacggtagcgatc
ggctcgtcgctgaaattctgtctggtggctgaaggtgcggcacaactttatccgcgcttc
ggaccgaccaatatctgggataccggcgccggtcatgctgtcgcgctggctgccggtgcg
caggtacatgactggaaagggcagacgctgaactacgtgccacgcgaatcgttcctgaat
ccgggcttcagagtgtctttattctga

DBGET integrated database retrieval system