KEGG   Rahnella sp. Y9602: Rahaq_0535Help
Entry
Rahaq_0535        CDS       T01422                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rah  Rahnella sp. Y9602
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rahaq_0535
Enzymes [BR:rah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rahaq_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
577982..580072
Genome map
AA seq 696 aa AA seqDB search
MENKALEQAAREAGIASGFINAHGKQQAIASETKRELLSAMGWVAGSRRPVATPVPSVKV
FVTGSRLALPVGGEGEYAWTLKLESGVTQKGRISGKMTLALPGKIPAGYHQLTLTQDAQQ
WECRVIVAPKRCYEPDALLAGKKLWGACVQLYTLRSENNWGIGDFGDLNLMLKNVAERGG
AFVGLNPIHALYPANPVAASPYSPSSRRWLNVIYIDVGAVDDFRQSDAAQQWWHQPLTQQ
RLQAVRANDWVDYASVMPLKLEGLRLAYAHFQGRKAQDPQVKSLRNFVKQGGESLYLQAA
FDALYEHLAKESDVALGWNRWPEKYHDARGPAVRAFCEQHAQDVEFYLWLQWLAETQFTQ
CYHTSQRHEMPMGLYRDLAVGVVAGGSETWGDGELYCLKASVGAPPDILGPLGQNWDLRP
MDPHVMVRRGYQPFIDLLRSNMTSCGALRIDHVMALLRLWWIPAGETADKGAYVQYPVDD
LLAILALESQRHRCMVIGEDLGTVPVEIVSKLRESGVYSYKVLYFERDEENNFRAPQSYP
VQAMATITTHDLPTLRGYWQSDDLALGKSLGLYRDEAVLQELYADRARARQGLLDGLHHY
GCIPKKTGHKAALMEMTPILNRGLQRYVADSACALLGLQPEDWLDMGAPVNVPGTSDEYP
NWRRKLSHTLEEMFADEQVNKLIKDLDKRRRKVSVS
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaaagcactggagcaggccgccagggaggcggggattgcttctggttttatt
aatgcgcacggcaaacaacaggcaatcgcttccgagaccaagcgtgaactgttatcggcg
atgggctgggtggcgggcagccgccgcccggttgccacgccggtgccgtcggtcaaagtg
tttgtcaccggcagccgtctggcattgccggtcggcggtgaaggcgaatatgcctggact
ctgaaactggaaagcggcgtgacccaaaaggggcggatcagcggcaaaatgacgctggca
ctcccgggtaaaattcctgccggttatcaccagctgacgttgacgcaggacgcgcaacag
tgggagtgtcgggtcattgtcgcgccgaaacgctgttacgaaccggatgcgctgctggcc
ggtaaaaaactgtggggcgcctgcgtgcagctttatacattgcgctcggaaaataactgg
ggcatcggtgattttggcgatctcaatctgatgctgaaaaacgtcgccgaacgcggcggc
gcgtttgtcgggcttaatccgatccacgcgctgtatccggcgaatccggtggccgccagc
ccttacagtccgtcatcccgccgctggctaaacgtgatttatatcgacgtcggcgcggta
gatgatttccggcagagcgatgcggcgcaacagtggtggcatcagccgctgacgcagcaa
cgtttgcaggcggtgcgcgccaatgactgggtggattacgccagcgttatgccgctgaaa
ttagaaggattacggctggcttacgcacattttcaggggcgtaaggcgcaggatccgcag
gtgaaatccctgcgcaacttcgtcaaacagggcggtgaaagcctgtatctgcaggctgcg
tttgatgcgctttacgagcatctggcgaaagaaagtgatgtggcacttggctggaaccgc
tggcctgaaaaatatcatgatgcccgtggcccggccgtgcgggcgttctgcgagcaacat
gctcaggatgtggagttttatctgtggctgcaatggctggcggaaacccagtttacgcag
tgttatcacaccagccagcggcacgagatgccgatggggctttaccgtgatctggcggtc
ggcgtggtggcaggcggatccgaaacctggggcgacggcgagctgtattgcctgaaagct
tcggtgggtgcaccgccggatattctcggcccgctcggtcagaactgggatctgcgcccg
atggatccgcatgtgatggtgaggcgcggctatcagccttttatcgatcttctgcgttcc
aacatgaccagttgcggcgcgttgcgcatcgatcatgtgatggcgttactgcgcctgtgg
tggatcccggcgggtgaaacggcggataaaggtgcgtacgtgcaatatccggtggatgat
ctgctggccattttagccctggaaagccagcgtcaccgttgcatggtgatcggcgaagac
ctgggcaccgtaccggtcgagatcgtcagcaaactgcgcgaaagcggcgtgtattcctac
aaagtgctgtatttcgagcgcgacgaggaaaataacttccgcgcgccgcagtcctatccg
gttcaggcgatggccacgattactacgcacgacctgccgacgctgcgcggctactggcaa
agcgacgatctggcgctgggaaaatccctcggtttgtaccgcgacgaggctgttttacag
gagctgtacgccgaccgcgcccgcgcacgtcaggggttgcttgatggtctgcatcattac
ggctgcatcccgaagaaaaccgggcataaagccgcactgatggaaatgacgccaatactc
aaccgtggtctgcaacgctacgtcgctgacagtgcctgtgccttgctcggcctgcaaccg
gaagactggctggacatgggcgcaccggttaacgtgcccggcaccagcgatgaatatccg
aactggcgccgtaagctttcccatacgctcgaagagatgtttgccgacgagcaggtgaat
aagctgattaaagacctcgataaacgccgccggaaagtatcggtgagctga

DBGET integrated database retrieval system