KEGG   Rahnella sp. Y9602: Rahaq_0722Help
Entry
Rahaq_0722        CDS       T01422                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rah  Rahnella sp. Y9602
Brite
Enzymes [BR:rah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Rahaq_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(766822..767331)
Genome map
AA seq 169 aa AA seqDB search
MKTSTLKRCSAAVVLGLMAALPGYSSLQVSEEGLRLITDFEGCQLQPYQCSAGVWTSGIG
HTAGVKPAQEVTEHQAAENLLGDIQQTERAVKKCMPVIMPQPVFDAVVSFSFNVGTGAAC
KSTLAFFINQQQWQQACDQLPRWVFVNGERNRGLERRRNAERTLCLKGV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctcaactcttaaacgctgtagtgccgccgtggtcctggggctgatggcagca
ctgccaggctacagctccttgcaggtgtcagaagagggtctgcggttgatcaccgatttt
gaaggctgtcagctgcaaccctatcaatgcagcgctggcgtatggaccagcggcatcggt
catacggccggcgttaaaccggcacaggaagtcaccgaacatcaggccgctgaaaatctg
ctgggggatattcagcagacagagcgcgccgtaaaaaaatgtatgccggtgatcatgccg
caaccggtttttgatgccgtggtgtccttcagttttaacgtcggcaccggtgccgcctgt
aaatcaacactggcgtttttcatcaaccagcagcagtggcaacaagcctgcgaccagttg
ccacggtgggttttcgttaatggcgaacgcaaccggggtctggaacgcaggcgaaatgcc
gaacgtactctctgcctgaaaggagtctga

DBGET integrated database retrieval system