KEGG   Rahnella sp. Y9602: Rahaq_0773Help
Entry
Rahaq_0773        CDS       T01422                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq_0773
   01230 Biosynthesis of amino acids
    Rahaq_0773
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_0773
   00030 Pentose phosphate pathway
    Rahaq_0773
   00051 Fructose and mannose metabolism
    Rahaq_0773
   00052 Galactose metabolism
    Rahaq_0773
  Energy metabolism
   00680 Methane metabolism
    Rahaq_0773
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rahaq_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(825544..826488)
Genome map
AA seq 314 aa AA seqDB search
MTKIVTLTLAPSLDSATLTPKIYPEGKLRCTAPVFEPGGGGINVARAIVYLGGQATALFP
TGGPTGAHLVQLLRDEGITTDTLETQDWTRQNLHVHTENTGEQYRFVMPGARLTEAEFAG
LSAKIEKIPAGSILVISGSLPPGTHITTLTELIRKAQKAGLRCILDSSGDALAAGLKLGG
LALVKPNQNELAALVGHSLENPGDVLAAAQQIIRDGGAERVVVSLGPQGALAVDANSSFQ
VVPPPVKKMSTVGAGDSMVGAMTLKLAEGADLLDMVRFGVAAGSAATLNIGTRLCSDKDT
QQIYQYLCQQTPAH
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatagtcacactcacactggcaccttcgctcgacagtgccactctcacccct
aagatttacccggaaggtaaattgcgttgtacggcccccgtgttcgaacccggcggcgga
ggtatcaatgtagcgcgtgccattgtttatctgggcggccaggctaccgcattatttccg
acgggaggcccgacaggtgcacatctggttcagttgctgcgcgacgaggggatcaccaca
gacacgctggaaacccaggactggacccgccagaacctgcacgttcacaccgaaaatacc
ggcgaacagtatcgtttcgtgatgccgggcgcacgacttacggaggctgaattcgcgggc
cttagcgcgaaaatcgaaaagatccctgccggctcaatactggtcatcagcggcagtttg
ccaccgggcacgcacattacgacactgacagagttaatcaggaaagcgcagaaagccggt
ttacgctgcattcttgacagttcgggtgatgcactggccgcgggcctgaagctcggcggg
ctggcgctggtcaaaccgaaccagaatgaactggccgcgctggtcgggcattctctggaa
aatccgggggatgttctggctgcagctcagcaaattatccgtgacggtggtgctgaacgc
gtggtcgtttcactggggccgcagggtgcgctggccgttgacgcgaacagctcattccag
gttgtcccaccgccggtgaaaaaaatgagtaccgttggcgcaggtgacagcatggtcggc
gcgatgaccctcaaactggccgaaggggctgatttactcgacatggttcgctttggcgtg
gccgccggtagcgcggcaacactcaatatcggtacgcgtctgtgctcggataaagatact
cagcaaatttatcagtatctgtgccagcaaacaccggctcattag

DBGET integrated database retrieval system