KEGG   Rahnella sp. Y9602: Rahaq_0780Help
Entry
Rahaq_0780        CDS       T01422                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rah  Rahnella sp. Y9602
Brite
Enzymes [BR:rah01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Rahaq_0780
Secretion system [BR:rah02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Rahaq_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
830870..831589
Genome map
AA seq 239 aa AA seqDB search
MKKGLMLLTLLAACMSSAVHADEAAIKATLGKLGMSHADIQPSPVTGLSAVSTDSGTLYI
TDDGKHVLQGPLYDVSGSHPVNVTNKALVKKMDALQNEMIIYKAKNEKHVITVFTDITCG
YCHKLHQQIQDYNDLGITIRYLAFPRQGLNSKTEKDMQSIWCTGNRKTNFDAAMRGDDIT
PATCKTSDIAKQFELGVQFGVTGTPAIVLADGTLIPGYQPPKEMAAMLDQQDPSHKTGG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttaatgctgctgacacttctggctgcgtgtatgagctccgcggtccat
gctgatgaagcagcaatcaaagccacgctgggcaaactgggcatgagccatgccgacatc
cagccttcgccggtaaccggcctgagtgcggtttctaccgacagcggcaccctttacatt
accgacgacggcaaacacgttttgcaaggcccgctgtatgacgtcagcggcagccatccg
gttaacgtcaccaacaaagcgctggtgaagaagatggatgcgttacaaaacgagatgatc
atttataaagccaaaaacgaaaagcatgtgatcacggtgtttaccgatatcacctgcggt
tattgccacaagctgcatcagcagatacaggactataacgatcttggcataaccatccgt
tatctggccttcccgcgtcaggggctgaattccaaaaccgagaaagacatgcaatctatc
tggtgtacaggcaaccgcaaaaccaactttgatgcggcaatgcgcggcgatgacatcacg
ccggcaacctgtaaaaccagtgatattgcgaagcaatttgagctgggcgttcagttcggc
gtgacaggcactccggccatcgtgctggcagacggaactttgatccctggttatcagccg
ccgaaagaaatggctgccatgctcgaccagcaggatccttcacataaaaccggtggttga

DBGET integrated database retrieval system