KEGG   Rahnella sp. Y9602: Rahaq_0947Help
Entry
Rahaq_0947        CDS       T01422                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
rah  Rahnella sp. Y9602
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:rah00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1012407..1012952
Genome map
AA seq 181 aa AA seqDB search
MSALTIFSDQDPSAPLWESRDGDAIAAELSKIDVRFERWQADRDLGENPQPQDVIAAYQH
EIDKLVEEKGYQSWDVISMRPDNEQREVLRTKFLSEHTHGEDEVRFFVEGAGLFCLHLNG
KIFQILCEKNDLISVPANTRHWFDMGGSPSFTAIRVFDNPEGWVAHFTGDKIADAYPRMG
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattaacgatttttagtgaccaggatccttccgcaccgttgtgggaaagccgc
gacggggacgcgatcgctgctgaactgagcaaaattgatgtgcgtttcgaacgctggcag
gctgaccgcgatttaggcgagaacccgcagccgcaggacgtgattgccgcctatcagcat
gaaatcgacaaactggtcgaagagaagggctatcagagctgggatgtgatcagcatgcgc
ccggacaacgaacagcgtgaggtgctgcgcaccaaatttctctctgaacatacacatggc
gaagacgaagtgcgtttcttcgtcgaaggtgccgggctgttttgcctgcatctgaacggc
aagatttttcagatcctgtgcgagaaaaacgatctgatttccgtaccggctaatacccgc
cactggtttgacatgggcggatccccgtcatttaccgcgatccgtgtattcgataatccg
gaaggctgggtagcgcatttcaccggcgataagattgcggatgcgtatccgcggatgggg
gagtaa

DBGET integrated database retrieval system