KEGG   Rahnella sp. Y9602: Rahaq_0947Help
Entry
Rahaq_0947        CDS       T01422                                 

Definition
(GenBank) Acireductone dioxygenase (Fe(2+)-requiring)
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00270  Cysteine and methionine metabolism
rah01100  Metabolic pathways
Module
rah_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rahaq_0947
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Rahaq_0947
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Rahaq_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2
Motif
Other DBs
NCBI-ProteinID: ADW72572
JGI: Rahaq_0947
UniProt: A0A0H3FC30
Position
1012407..1012952
Genome map
AA seq 181 aa AA seqDB search
MSALTIFSDQDPSAPLWESRDGDAIAAELSKIDVRFERWQADRDLGENPQPQDVIAAYQH
EIDKLVEEKGYQSWDVISMRPDNEQREVLRTKFLSEHTHGEDEVRFFVEGAGLFCLHLNG
KIFQILCEKNDLISVPANTRHWFDMGGSPSFTAIRVFDNPEGWVAHFTGDKIADAYPRMG
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcattaacgatttttagtgaccaggatccttccgcaccgttgtgggaaagccgc
gacggggacgcgatcgctgctgaactgagcaaaattgatgtgcgtttcgaacgctggcag
gctgaccgcgatttaggcgagaacccgcagccgcaggacgtgattgccgcctatcagcat
gaaatcgacaaactggtcgaagagaagggctatcagagctgggatgtgatcagcatgcgc
ccggacaacgaacagcgtgaggtgctgcgcaccaaatttctctctgaacatacacatggc
gaagacgaagtgcgtttcttcgtcgaaggtgccgggctgttttgcctgcatctgaacggc
aagatttttcagatcctgtgcgagaaaaacgatctgatttccgtaccggctaatacccgc
cactggtttgacatgggcggatccccgtcatttaccgcgatccgtgtattcgataatccg
gaaggctgggtagcgcatttcaccggcgataagattgcggatgcgtatccgcggatgggg
gagtaa

DBGET integrated database retrieval system