KEGG   Rahnella sp. Y9602: Rahaq_0985Help
Entry
Rahaq_0985        CDS       T01422                                 

Definition
xylose isomerase domain-containing protein TIM barrel
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rah  Rahnella sp. Y9602
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rahaq_0985
   00051 Fructose and mannose metabolism
    Rahaq_0985
Enzymes [BR:rah01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Rahaq_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1048576..1049556
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGAHLYWPEQKGKPSVLQMIERAATVKGLTHLDLNYPQHMTGDITL
MRQKIEEVGLAVNGMQMRWDAPEFKIGAFTHPDPKIRRQAIELTKRGIDAGREFGASIMT
LWMGQDGFDYCFQADYKKIWEDAVSAVREVAEYAPDIDVSIEYKPNEPRAYSIFPNATTC
LLAVEEAGCKNLGITLDFAHVLFANEVPAFAAAMVARRSRLLGLDLNDGWGKRDDGLMVG
SVNPRATLEFLLQMKRDGYKGAYYFDTFPDASGLDPVREAETNIATVIRLLKLCEKLENN
PALNEAISRQDAVATQQIVNDVMLAQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacttaaatttgccacacgtctgaactcgtttgcgtcgggggcacatctttac
tggcctgaacagaaaggcaaaccttcagtgctgcaaatgatcgaacgtgcagctacggtt
aaaggattgacgcatctggacctgaattatccgcagcacatgaccggcgatatcactttg
atgcgccagaaaatcgaagaagtcgggctggcggtgaacgggatgcaaatgcgctgggat
gctccggaatttaaaatcggcgcatttactcacccggatccaaaaattcgtcgtcaggcg
attgaattgaccaaacgcgggatcgacgccggtcgtgagtttggtgccagcattatgacg
ttgtggatgggacaggatggctttgattactgtttccaggctgactacaaaaaaatctgg
gaagacgcagtcagcgctgtgcgtgaagtggcggaatacgccccggatatcgacgtcagc
attgaatacaaacccaacgaaccacgcgcttacagcattttcccaaatgccactacctgt
ctgctggcggttgaagaagccggttgcaagaacttaggtatcacactggatttcgcgcat
gtgttgtttgccaacgaagtaccggcgtttgcggcggcgatggtagcccgccgttcgcgt
ttgctggggctcgatctcaatgacggctggggcaaacgcgacgacggcctgatggtcggc
tccgtcaacccgcgtgccacgctggaattcctgttgcagatgaaacgcgacggctataaa
ggcgcgtattacttcgataccttcccggacgccagcggattggatccggtgcgtgaagca
gaaaccaatatcgcgaccgtgatccgtttactcaaactttgcgaaaaactcgagaataac
ccggcgctgaatgaagccatcagcaggcaggacgccgtagccacacagcaaatcgtcaac
gacgtgatgttggcgcagtaa

DBGET integrated database retrieval system