KEGG   Rahnella sp. Y9602: Rahaq_0995Help
Entry
Rahaq_0995        CDS       T01422                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
rah  Rahnella sp. Y9602
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rah00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rahaq_0995
Enzymes [BR:rah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Rahaq_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1063935..1065989
Genome map
AA seq 684 aa AA seqDB search
MKINSREDIAQLLASWVECGWLRELDRALVTFLAKEAPDAHPLLLLATALTSYQLGRGHV
CLDLQATLDDSAFSLSLPPEGDHADGAVIRPAAVLDDLSLQEWLAALVHPTLVGHHEGNS
PLVLTGQRLYLRRYWQYEQNVRAAIEQRLARSALHTLPVESLRAPLTALFPADAKSDIAN
WQKLACALAAGSAFSIITGGPGTGKTTTVVRLLALLQTLALEENGQPLRIRLAAPTGKAA
ARLNESIAGAVSKLDLSAIGNGNAVRESINTDVVTLHRLLGSRPDTRHFRHHPGNPLMLD
VLVVDEASMVDLEMMAALLAALPEQARLILLGDKDQLASVEAGALLSELCQRANGGHYLP
HTRDWLQSVTGEQIPDSLVDPQGTAMDQAVVMLRHSYRFDAQSGIGQLAEAVNDGDVKAL
KQVWKHGYADLAQLTLSTDDDAELRDWVVKGGTKQFPAAARREGVEPPVGYQHYLNVMIQ
ARPADNEPPEAFNRWAARVLLAYSQFQLLCALRGGRWGVEELNQRIADILRKEGLLKASI
GWYPGRPVLVTRNDYSQRLMNGDIGITLEIPHRLADGTVVPTLRVAFLAGDGTQDIRWVM
PGRLQAVETVFAMTVHKSQGSEFTHTALLLPENLSPILTRELIYTGITRARHWFSLGCVG
GMNAVLPDAVKRRVLRASGLIESA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaacagccgtgaagatatcgcacaactgctggcgagctgggtggaatgtggc
tggctgcgcgaactcgatcgcgcactggtgacgtttctggcaaaagaagcgccggacgcg
catccgttattgttgctggcgaccgcactgaccagctatcagttagggcgcggtcatgtg
tgtctggatttgcaggccacgcttgatgacagcgcattctcactctcgctgccaccggaa
ggcgatcacgctgacggcgcggtgatccgtccggcggccgtgctcgacgacctgagtttg
caggaatggctggcggcgctggtgcacccgacgctggtcggacaccacgaaggtaattcg
ccgctggtgctgaccggccagcgcctgtatctgcgccgttactggcagtacgaacagaat
gtgcgggcggcaattgaacaacgtctggcgcgcagtgcgctgcacactttgccggtggaa
tctttgcgtgcgccgctgacggcgttattcccggcggatgcgaaatctgatatcgccaac
tggcagaaactggcctgcgcgctggcggcgggcagtgcgttcagcattattaccggcggg
ccgggcaccggtaaaaccaccacggtggtgcgtctgctggcgttgttacagacgctggcg
ctggaggaaaatggtcagccactgcgcatcagactggccgcgccgaccggcaaggcggca
gcaagactcaatgaatcaattgccggtgcggtatcgaagctggatctcagtgcgatcggc
aacggtaatgcggtgcgagaaagtatcaacaccgatgtggtgacactgcaccgtctgctc
ggcagccgccccgatacgcggcattttcgccatcatccgggcaacccgctgatgctggat
gtgctggtggttgatgaagcgtcaatggtcgatctggaaatgatggccgcattgctggcg
gcattgccggaacaggcgcgtctgatcctgctcggcgataaagatcaactggcgtcggtg
gaggcgggggcattactgagcgagttatgtcagcgcgccaacggcggccattatctgccg
catacccgcgactggttgcaaagcgtgaccggcgaacagatcccggattcgctggttgat
ccccagggtacggcgatggatcaggctgtagtgatgctgcgccacagttaccgttttgat
gcacaaagcggcattggtcagttagcggaagcagtaaatgacggggatgtgaaagcgctg
aaacaggtctggaaacatggatacgctgacctggcgcaactgacattgagcactgacgat
gatgctgaactgcgcgactgggtggtgaagggcggcacgaagcagttcccggcggcggcc
agacgcgaaggcgtagaacctccggtcggctatcaacattatctcaacgtgatgatccag
gcgcgaccggcagacaatgaaccgccggaagccttcaaccgctgggcggccagagtgctt
ctggcctacagccagttccagctgctgtgcgccttacgtggcgggcgctggggtgtggaa
gaactgaatcagcgcatcgccgacatcttgcgaaaggaagggttgcttaaggcgtcgatc
ggctggtatccggggcgtccggtgctggtgacccgcaatgattacagccagcgtctgatg
aacggcgatatcggcatcacgctggagatcccgcatcgtcttgccgatggtactgtggtg
ccgaccctgcgagtggcgtttctggccggagacggtacgcaggatatccgctgggtgatg
ccggggcgtttgcaggcggtggaaaccgtatttgccatgacggtgcacaaatcacaggga
tccgaatttacccataccgcgctgctgctgccggagaatctcagtccgatcctcacgcgc
gagctgatttacaccggcattacccgtgcgcgtcactggttcagtctgggatgtgtcggg
ggaatgaatgccgttttaccggatgcggtgaagcgtcgggtgttacgtgccagcggatta
atcgaaagcgcgtaa

DBGET integrated database retrieval system