KEGG   Rahnella sp. Y9602: Rahaq_1590Help
Entry
Rahaq_1590        CDS       T01422                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rah  Rahnella sp. Y9602
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rah00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1742629..1744698
Genome map
AA seq 689 aa AA seqDB search
MTKFPLLSSKISGLLHGADYNPEQWLESPDVLIRDVEMMKEARCNVMSVGIFSWSALEPE
EGHFTFGWLDQVLDKLHENGISVFLATPSGARPAWMSQKYPEVLRVGRDRVKALHGGRHN
HCMSSPVYAEKVQLMNSALAKRYAHHPAVIGWHISNEYGGECHCHYCQTRFRDWLKARYV
TLDALNQAWWSTFWSHTYTDWAQIESPSPQGESGIHGLNLDWRRFNTDQVTRFCSEEIRP
LKAENPALPATTNFMEYFYDYDYWKLASVLDFISWDSYPMWHTRNDDIGLAAYTAMYHDL
MRTLKQGQPFVLMESTPSFTNWQPVSKLKKPGMHILSSLQAVAHGSDSVQYFQWRKSRGS
SEKFHGAVVDHVGHIDTRVGREVAELGGILSALAPVAGSRVEARVAIIFDWESRWAMDDS
LGPRNQGLEYENTVAGHYRALWSQGIAVDVINADCDLTGYDLVIAPMLYMVRAGVGERIT
AFVQAGGRFVATYWSGIVNESDLCFLNGFPGPLRPVLGIWAEEIDSLTDDQHNSVSGTEG
NALGLNGPYRASELCEVIHLEGAAALATYGDDFYAGTPAVTVNLFGKGQAYYLASRNDQQ
FHADFYTALAKEMKLPRAIATDLPEGVTAARRTDGESEFIFLQNYAADSQTVTLPDDYRD
MVHGGILPRTLTLPAFGCQILSRRLSVIS
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatttcctcttctgagcagtaagatttccgggctattacatggtgcggattac
aacccggaacagtggctggaaagccccgatgtgctgattcgcgatgtcgaaatgatgaaa
gaggcgcgctgtaatgtcatgtcagtcggaatttttagctggtcagcgctggagcctgaa
gaaggtcattttacctttggctggctggatcaggtgctggacaaattgcatgaaaatggc
atctcggtatttcttgccacaccaagcggcgcacgtccggcgtggatgtcgcaaaagtat
cctgaagttctgcgtgtcgggcgtgaccgcgtaaaagcactgcacggcgggcgtcacaat
cactgtatgagttcgccggtgtatgccgaaaaagtgcaactgatgaacagtgcgctggcg
aagcgttacgcccatcatccggcggtgattggctggcatatttccaacgaatacggcggc
gagtgccattgccattactgccagacccgtttccgcgactggctgaaagcccgttacgtc
acgctcgatgcgctgaatcaagcctggtggagcactttctggagccacacctataccgac
tgggcgcagatcgaatcgccgtcgccgcagggcgaaagcggcattcacggcctgaatctc
gactggcgtcgttttaacaccgatcaggtcacccgtttttgcagcgaggaaatccgcccg
ctcaaagcggagaatccggcgttaccggcgaccaccaatttcatggaatatttctacgat
tacgattactggaaactcgccagcgtgctggatttcatctcgtgggacagctatccgatg
tggcatacccgcaatgatgatatcggtctggcggcgtacaccgcgatgtatcacgattta
atgcgtacgctgaaacagggccagccgtttgtgctgatggaatcgacgccgagtttcacc
aactggcagccggtcagcaaactgaaaaagccgggcatgcatattctgtcttctttgcag
gcggtcgctcatggttcggattctgtgcagtatttccagtggcgtaaaagccgcggttcg
tcagaaaaattccacggcgcggtcgtcgatcacgtcgggcatatcgatacccgtgtcggg
cgcgaagtggccgaactgggcgggattctatcggcgctggctccggtggcgggcagccgc
gttgaagccagagtggcaattatcttcgactgggaaagccgctgggcgatggacgattcc
ctcggaccgcgcaatcagggactggaatatgaaaacacggttgccggacattaccgcgca
ctgtggtcgcagggcattgcggtcgatgtgatcaatgccgattgcgatttaaccggttac
gacctggtgattgcgccgatgctgtatatggtgagggcaggcgtcggcgagcggatcacc
gcgttcgtgcaggccggcgggcggttcgtcgcgacttactggagcggtatcgttaacgaa
agcgatttgtgtttcctcaacggattcccgggaccgttgcgtccggtactgggtatctgg
gcggaagaaatcgacagcctgaccgacgatcagcacaacagcgtcagcggcactgaaggc
aatgcgctggggttaaacggcccgtatcgtgccagcgaattgtgtgaagtgatccacctg
gaaggtgcggccgcactggcgacgtacggtgacgatttctacgccggcacgccagccgtg
accgtgaatctgtttggcaaagggcaggcgtattatctggcttcccgaaacgatcagcaa
ttccacgccgatttttataccgcgctggcgaaagaaatgaagctgccacgggcgatagcc
accgatctgcctgaaggtgtcactgccgcacgacgcaccgacggtgaaagtgaatttatc
ttcctgcaaaactatgccgccgacagccagacggtgacattgccggatgattaccgcgat
atggttcacggcggtatattaccgcgcacactgacgcttccggcattcggttgtcagatc
ctgtcgcggcgtttatctgttatttcttaa

DBGET integrated database retrieval system