KEGG   Rahnella sp. Y9602: Rahaq_1646Help
Entry
Rahaq_1646        CDS       T01422                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rah  Rahnella sp. Y9602
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rahaq_1646
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rahaq_1646
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rahaq_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1798378..1798860
Genome map
AA seq 160 aa AA seqDB search
MITFHQLTATSLDGQLISMADYAGKLVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIAQTCHINYGVSFPIFEKVEVNGAATHPVFRYLKNELPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPFTTPEKMETVILAALEI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcacctttcatcaactcaccgccaccagtctggatggccagctcatctctatggcc
gactatgcgggtaagctggttctggtggtgaataccgccagccattgtggcttcacgcca
caatacgcaggccttgaagcgctctacaagaagtacgctgcacagggtctggtggtgctt
ggttttccctgcaaccagttcggtaagcaggaacccggcggcgccgacgaaatcgcgcag
acctgtcacatcaactatggtgtgagcttcccgatattcgaaaaagtggaggtcaacggc
gctgctacgcacccggtgtttaggtatctgaaaaacgaattgcccggtgtactcggtggg
cggatcaagtggaacttcactaagttcctgatcggacgcgacggcaaaccgctcaagcgt
tttgcaccgttcaccaccccggagaaaatggaaaccgtaatacttgctgcacttgaaatc
taa

DBGET integrated database retrieval system