KEGG   Rahnella sp. Y9602: Rahaq_1667Help
Entry
Rahaq_1667        CDS       T01422                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rah  Rahnella sp. Y9602
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rahaq_1667
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rahaq_1667
Enzymes [BR:rah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rahaq_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1818497..1819660)
Genome map
AA seq 387 aa AA seqDB search
MSLSSPDISRMKRDLAALVAINTENPPGREREAAELISAMLSDIGFDLTLSEYAPGRTNV
IGRLENGSGPCFAFNTHIDVVPAGEGWQQDPFTLTERDGRLYGRGACDAKGPLIAMIEAM
RWLAANRNDWRGTLMAIFVADEEVASEGAKFYVREAPAHIDYVVIGEPTSNTTYSAHKGS
LRPLVRVHGVTAHSGTPELGENAIFRAAQLLGLVEETHEHTVRCRCHPLVGNASLTVTRI
SGGHADNVLPGACELLLDRRMVPGEDENAVKQEIQDLLQLAQEKFGVRSEIITYKPTTGG
ATETDSDDPIVRAGVEACAAQGNPEPGPFGFQGGCDLVHFRSLGTKGIIIGPGSLAVAHK
PDEFIPIDEFVAGSKIYCDVALKMLKH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtctttcatcgcccgatatcagcagaatgaaacgcgatcttgccgcactggtggcg
atcaataccgaaaacccgccgggacgtgaacgcgaggccgcagagcttatcagcgccatg
ctcagcgacatcggcttcgacctgacgctcagcgagtacgcaccgggacgcaccaacgtg
attggcaggctggaaaacggcagcggcccgtgctttgcctttaatacccacatcgacgtc
gtaccggccggtgaaggctggcagcaggatccgttcaccctcaccgaacgcgacgggcgg
ttgtatggccgcggagcctgcgacgctaaaggcccgctgatcgccatgatcgaagccatg
cgctggctcgcggccaaccgcaatgactggcgcggcacgctgatggcgatttttgtcgcc
gacgaagaagtcgccagcgaaggcgcgaagttttatgtgcgcgaagccccggcgcatatc
gattacgtggtgatcggcgaaccgacgtccaacaccacatactcggcgcacaaaggcagt
ttacgtccgctggttcgcgttcatggcgtcaccgcgcattccggcacaccggagctgggc
gagaacgctattttccgtgccgcgcaactgctcggtctggtggaagaaacgcatgaacat
accgtgcgttgtcgctgccatccgctggtcggtaacgccagcctgacggtcacgcgcatt
agcggcggacatgccgataacgtgctgccgggcgcctgcgaattattgctcgaccggcgt
atggtgccgggcgaagacgaaaacgccgtgaaacaggaaattcaggatttactgcaactg
gcgcaggaaaaattcggtgtgcgcagcgaaatcatcacctacaaacccaccaccggcggt
gcgaccgaaaccgattcggacgatccgattgtgcgggcgggcgttgaagcctgcgccgcc
cagggcaatccagaacccggcccgttcggttttcaggggggatgcgatctggtgcatttt
cgcagtctgggcactaaaggcatcatcatcggccccggttcgctggccgtcgcgcataaa
cctgatgaatttatccccatcgatgaattcgtggcaggcagcaaaatttactgcgatgtt
gccttaaaaatgctcaaacactga

DBGET integrated database retrieval system