KEGG   Rahnella sp. Y9602: Rahaq_1717Help
Entry
Rahaq_1717        CDS       T01422                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rah  Rahnella sp. Y9602
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rah00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rahaq_1717
Enzymes [BR:rah01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rahaq_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1870696..1871310
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVHMPMTCFYELPELGQEAIIFTQFIVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVSAVEKEEITALIKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNHTDITLPASASKAKESDAEGEAVAALISLGYKPPEASR
MISKVAKPGAESETLIREALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactacgaggcattattctggaaaaacagccccctttggtgctgcttgaa
accaacggcgtgggctatgaagtgcatatgccgatgacctgtttttatgaattgccggaa
ctgggtcaggaagctatcatcttcacgcaatttatcgtccgtgaagatgcccagttgctc
tacggatttaacgataaacaagagcgcgcgctgttccgcgagctgattaaagtcaacggc
gttgggccgaagctggcgctggcgattctgtcaggcatgtcggcgcagcagtttgtcagt
gcggtagaaaaggaagaaatcaccgcattaattaagttacctggcgtcggtaagaaaacc
gcagaacgcctggtcgtcgaaatgaaagaccggtttaaaggattaaacggtgatctattt
aacaatcatactgatatcacgctacctgcatcggcgtcgaaagctaaagaatctgacgcc
gaaggcgaagccgttgcagcgctgatatccctcggatataaaccaccggaagccagccgc
atgatcagcaaggtggccaaaccgggcgcagaatctgaaacgttgattagagaagcgctg
cgcgcagcgctgtga

DBGET integrated database retrieval system