KEGG   Rahnella sp. Y9602: Rahaq_1748Help
Entry
Rahaq_1748        CDS       T01422                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rah  Rahnella sp. Y9602
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rahaq_1748
   00052 Galactose metabolism
    Rahaq_1748
   00500 Starch and sucrose metabolism
    Rahaq_1748
   00520 Amino sugar and nucleotide sugar metabolism
    Rahaq_1748
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rahaq_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1908795..1909682
Genome map
AA seq 295 aa AA seqDB search
MLKAVIPVAGLGTRMLPATKAIPKEMLPIVDKPLIQYIVNECAAAGIKEIILVTHSSKNA
IENHFDTSFELESMLESRVKRQLLEEVQSICPKGVTIMNVRQGQSKGLGHAVLCAKPLIG
NSPFAVILPDVLMDDSTSDLRKDNLAAMLRRFQETGNSQVMVEEVPEKDVSKYGIVNCNG
VEVEPGESAPMTAIVEKPELKDAPSNLAVVGRYVLSEAIWPLLAVTPYGAGNEIQLTDAI
AMLMKKHTVEAFSMTGRSHDCGDKLGYMKAFVEYGIRHNTQGEAFKAWLKEFAEE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagctgttatccctgttgccggtctgggcacacgtatgttgccagcgacgaaa
gccattccaaaagaaatgctgcctatcgtcgataagcctttgatccagtacatcgttaat
gaatgtgctgcggcgggcatcaaagaaatcattctggtcacacactcttcgaaaaacgcg
atcgaaaaccacttcgatacctctttcgagctggaaagtatgcttgaatcccgtgtgaaa
cgtcagctgctggaagaagtgcagtctatctgcccgaaaggcgtgaccatcatgaacgta
cgtcaggggcaatcaaaaggccttgggcatgcggttctgtgtgcaaaacctctgattggt
aattctcctttcgcggttattctgccagacgttttgatggatgattccaccagcgatctg
cgtaaagataaccttgctgccatgcttcgtcgcttccaggaaactggcaacagccaggtc
atggttgaagaagtgccggagaaagacgtttccaagtacggtattgttaactgcaacggc
gtagaagttgagccgggcgaaagcgcgccaatgacggctatcgttgaaaagccggaactg
aaggacgcgccatcaaaccttgcggttgtcggccgttatgttctgtccgaagctatctgg
ccactgctggcagtgacaccgtatggtgcaggtaatgaaattcagctgactgatgccatt
gccatgctgatgaaaaaacatactgttgaagccttctccatgactggccgttcacatgac
tgtggtgataagctcggttacatgaaggcgtttgttgagtatggtattcgccataacacg
cagggcgaagcgttcaaggcatggttgaaagagtttgctgaagaatag

DBGET integrated database retrieval system