KEGG   Rahnella sp. Y9602: Rahaq_1797Help
Entry
Rahaq_1797        CDS       T01422                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rah  Rahnella sp. Y9602
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1953639..1954169
Genome map
AA seq 176 aa AA seqDB search
MANLKTKLSAAMLALIAAGACAPVLMEQFQKEKEGTSLIAYQDQGGVWTICGGVTSVNGK
PVFKGMKLTREQCETIDKAEQAKALDWVEKNVHVPLTEPQKVGIASFCPWNIGPGKCFPS
TFYGKISAGDRLGACAEIKRWIWDGGKDCRIRSNNCAGQVIRRDQESELTCWGLDE
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaccttaaaactaaactcagtgccgcaatgctggcgctgattgctgctggcgca
tgcgcacctgtgctgatggaacagttccaaaaagagaaagaaggcaccagcctgattgct
tatcaggatcagggcggcgtctggactatctgtggtggcgttacttctgtgaatgggaag
cctgtgttcaagggcatgaaattaacccgggagcagtgcgaaaccatcgataaagcagag
caggccaaggcgttggattgggttgagaagaatgttcacgttcctttgaccgagccgcag
aaagttggcattgcttcattctgcccgtggaatatcggccccggcaaatgcttcccttcg
acgttctacggcaaaattagcgctggtgatcgtctcggagcatgcgcagagattaaacgc
tggatctgggatggcgggaaggactgccgaattcgttcgaacaactgcgctggtcaggtc
atcaggcgtgatcaggaaagcgaactgacgtgctgggggctggatgaataa

DBGET integrated database retrieval system