KEGG   Rahnella sp. Y9602: Rahaq_1833Help
Entry
Rahaq_1833        CDS       T01422                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rah  Rahnella sp. Y9602
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rah00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rahaq_1833
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rahaq_1833
Enzymes [BR:rah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rahaq_1833
Two-component system [BR:rah02022]
 CheA family
  CheA-CheYBV
   Rahaq_1833
Bacterial motility proteins [BR:rah02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rahaq_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1988246..1989295
Genome map
AA seq 349 aa AA seqDB search
MNKIRVLSVDDSALMRQLMTEIINSHPDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAIDFVTKPQLGIREGMLAYS
EMIADKIRTASKARLNKSVNIDQPRILSHTPLLSSEKLIAIGSSTGGTEAIRHVLQPLPP
TCPALMITQHMPPGFTRSFADRLNKLCQITVKEAEDGERVLPGHAYIAPGDRHMELTRSG
ANYQVKLNDGPAVNRHRPSVDVLFRSVAQFAGRNAVGVILTGMGNDGAAGMLEMHRAGAY
TLAQNEASCVVFGMPREAIATGGVNEVVDLSQISQRMLAQISAGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcagagtgttgagcgtcgatgactcggcgttaatgcgtcagctgatgact
gaaatcatcaacagccatccggatatggaaatggtcgcgaccgcccccgatccgctggtg
gcgcgtgatctcatcaagaaatttaacccggacgtgctgacgctggatgttgaaatgccg
cgtatggacggcctggattttctcgaaaagctgatgcgtctgcgtccgatgccggtggtg
atggtctcctcactgaccggcaaaggctcggaaattaccctgcgtgcactggagcttggc
gcgattgactttgtgaccaaaccgcaactgggtatccgtgaaggtatgctggcctacagc
gagatgattgccgataaaatccgcacggcctcaaaagcgcgtctgaacaaaagcgtcaac
attgatcagccgcgtattctcagccatacgccgctgctgagcagtgaaaaactgattgcc
atcggctcatcaacgggcggcacagaggctatccgccacgtgctgcaaccgctgccgccg
acctgtccggcgctgatgattacccagcatatgccaccgggtttcacccgttctttcgcc
gaccgtctgaacaagttatgtcagatcacggtgaaagaagcggaagacggagagcgtgtt
ttgccgggccatgcgtatatcgcaccgggtgacagacatatggaactcacgcgcagtggc
gccaactaccaggttaagttgaacgacggtccggcggtgaaccgccatcgtccgtcggtc
gacgttttattccgttcggtggcgcagtttgccggacgcaatgccgttggggtgatcctg
acgggaatgggcaatgacggcgccgccggcatgcttgagatgcaccgggcaggggcttac
acccttgcacaaaacgaagccagttgtgtggtgttcggtatgccccgtgaggctatcgcc
accggtggcgtaaacgaagtggtggatctcagccaaatcagccagcggatgctggcgcaa
atatcagccggtcaggcattacgtatttaa

DBGET integrated database retrieval system