KEGG   Rahnella sp. Y9602: Rahaq_2170Help
Entry
Rahaq_2170        CDS       T01422                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00340  Histidine metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01230  Biosynthesis of amino acids
Module
rah_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rahaq_2170
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rahaq_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADW73781
JGI: Rahaq_2170
UniProt: A0A0H3F975
Position
complement(2372063..2373403)
Genome map
AA seq 446 aa AA seqDB search
MSAPFQAVTFHDLSDSSELPAELFKRTEADLSFFTERVAPIIEAVRTEGDAALRRFARDF
DGVTAPHMSILAEDTEFETAFERLDPQVVESIRFAVENVRAFHEAQKPEDMWMKEIRPGA
FAGDRHVPIDSVACYVPRGKGSFPSVLLMTTIPAVVAGVKRAIVITPPGPDGKVDDATLV
AARLVGITEVYKCGGAQGVAAVAFGTETVPKCLKIVGPGSPWVVAAKRQLSNLIDPGIPA
GPSESLILADDTVDGALAALDLIIESEHGPDSSAYLVTSSRRVAEQAIAALPGYWAQLDE
KRAGFSQAVLCGTHGGVVLTADFTAAVEFVNQYAPEHLEILAEEPMAVMGKIRNAGEILL
GNYTPITLGNFVLGPNAVLPTNGAAKTVGPLSVFDYMKRISVGYVTREGYQPLADKAHAF
ALYEGFPGHALAVSALRTEIINKKGQ
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaccttttcaagccgtaacttttcatgatttgagtgattcgtctgaactgcca
gcggagctgttcaaacgcacggaagccgatttgtcgtttttcactgagcgcgttgcgccg
atcattgaagcggtgcgtaccgaaggcgatgccgccctgcgccgttttgcccgcgatttc
gacggcgttaccgcgccgcatatgagcattctggcggaagatacggaattcgaaacggcg
tttgaacgcctcgatccgcaggtggtggaatcgatccgtttcgccgtcgaaaacgtccgc
gccttccatgaagcacaaaaaccggaagacatgtggatgaaagaaatccgccccggcgcc
tttgccggtgaccgccatgtgcccatcgattccgtagcctgttacgtgccacgcggcaaa
ggctcattcccaagcgtgttactgatgaccaccattccggcggtggtcgcaggtgtaaaa
cgtgccattgtcatcaccccgcctggccccgacggcaaagtcgatgacgccacgctggtg
gccgctcgtctggttggcattaccgaagtgtacaaatgcggcggcgcacagggtgtcgct
gccgtggcatttggcactgaaaccgtgccgaagtgcctgaagatagtcggccccggcagc
ccgtgggtggtggccgccaagcgtcaactctcgaatctgatcgaccccggcattcctgcc
ggtccaagcgaaagcctgatcctcgccgatgacaccgtggacggtgcgctggcagcgctg
gatctgatcatcgaatcagaacatggcccggattcttcggcgtatctggtcaccagcagc
cgtcgggtcgctgaacaggccatcgccgcactgcccggttactgggcgcagctcgatgaa
aaacgggccggattctcacaggccgtattatgcggaacccacggcggcgtggtgctgaca
gcagatttcaccgcagccgttgaatttgttaatcagtacgcgccggaacatctggaaatt
ctggccgaagagccgatggccgtgatgggcaaaatccgcaatgccggtgaaatcctgctg
ggcaattacacaccgatcacgctggggaatttcgtcctcggaccgaacgcagttctgccg
accaatggcgcagcgaaaaccgtcgggccgctgtctgtgttcgattacatgaaacggatc
tccgtaggctatgtcacccgcgaaggctatcagccgctggccgataaagcacacgccttt
gcattgtatgaaggattccccggccacgcgctggcggtatcggctttacgcactgagatc
atcaacaaaaaaggccagtaa

DBGET integrated database retrieval system