KEGG   Rahnella sp. Y9602: Rahaq_2398Help
Entry
Rahaq_2398        CDS       T01422                                 

Definition
glycoside hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rah00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2627531..2628961)
Genome map
AA seq 476 aa AA seqDB search
MSASAFPEGFLWGGAIAANQAEGGSFEGGKGLTTVDMIPHGAHRLAVKTGQEKRFSLKDD
EFYPAHQAIDFYHRYKEDIALMAEMGFTVFRTSIAWSRLYPNGDEQVPNEEGIAFYRDVF
AECKKYGIEPLVTLCHFDVPMHLVIEYGSWRNRKMVEFFARYARTCFEAFDGLVKYWLTF
NEINILLHSPFSGAGLVFEEGENQEQVKYQAAHHELVASALATKIAHEVNPENQVGCMLA
GGNFYPQTCKPADVWAALQKDRENLFFIDVQARGEYPSYTRRVFAEKGVNVVTEPGDDDI
LKNTVDFVSFSYYASRCASADMNDNNSSAANIVKSLKNPYIEASEWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGAKDEINAQGEINDDYRISYLREHIRAMGEAITDGVPLIGYTS
WGCIDLVSASTGEMSKRYGFVYVDRDDAGNGTLERKRKKSFWWYRKVIASNGGDLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatcagcatttcctgaaggttttttatggggcggcgcgattgccgcaaaccag
gccgaaggcggcagtttcgaaggaggcaaagggctgaccacggtagatatgatcccgcat
ggcgcgcaccgtctggcggtaaaaaccggtcaggaaaaacgtttctccctgaaagacgat
gagttttatccggcgcatcaggcgattgatttctaccatcggtacaaagaagacatcgcg
ctgatggcagaaatgggctttaccgtgttccgtacctcaattgcctggagccgtctttat
ccgaacggtgatgagcaggtgccgaacgaggaaggtatcgcgttttaccgcgacgtattt
gcggaatgcaaaaagtacggcatcgaaccgctggtgacgctgtgccattttgatgtgccg
atgcatctggtcatcgaatacggctcgtggcgtaaccgcaaaatggtggagtttttcgcc
cgctatgcgcgtacctgttttgaagcgttcgacgggctggtgaaatactggctgaccttc
aacgaaattaacatcctgctgcacagcccgttctccggtgccggtttagtctttgaagag
ggcgaaaatcaggagcaggtgaaatatcaggcggcgcaccatgagctggtggccagtgct
ttagcgacaaaaattgcccatgaagtgaacccggagaatcaggtcggctgtatgctggct
ggcgggaatttctatccgcaaacctgtaaaccggctgatgtctgggcggccctgcaaaaa
gaccgcgagaacctgttcttcatcgatgtgcaggcgcgtggcgaatatccgtcatatacc
cgccgcgtctttgccgaaaagggcgttaacgtcgtgactgagccgggcgatgacgacatc
ctgaaaaacaccgtcgattttgtctcgttcagttactacgcgtcgcgttgtgcgtcagca
gacatgaacgacaacaacagcagcgcggcgaatattgttaaatcgctgaaaaacccgtac
atcgaggccagcgaatggggctggggcatcgatccgctcggtctgcgcatcaccatgaac
atgatgtacgaccgctatcagaagccgttatttctggtcgaaaacggcctcggcgcgaaa
gatgaaatcaacgcgcagggcgaaatcaacgacgattaccgcatcagctatctgcgcgag
catatccgtgcgatgggcgaagcgatcaccgatggcgttccgctgatcggctacacctca
tgggggtgtatcgatctggtctccgcctcgaccggtgaaatgagcaagcgctacggcttc
gtttatgtcgaccgcgacgatgccggtaatggcacgctggaaagaaagagaaagaaatcg
ttctggtggtacaggaaagtgattgccagtaacgggggggatctgggctaa

DBGET integrated database retrieval system