KEGG   Rahnella sp. Y9602: Rahaq_2642Help
Entry
Rahaq_2642        CDS       T01422                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rahaq_2642
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_2642
   00620 Pyruvate metabolism
    Rahaq_2642
   00650 Butanoate metabolism
    Rahaq_2642
  Lipid metabolism
   00071 Fatty acid degradation
    Rahaq_2642
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rahaq_2642
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rahaq_2642
   00626 Naphthalene degradation
    Rahaq_2642
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rahaq_2642
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Rahaq_2642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2874091..2876760
Genome map
AA seq 889 aa AA seqDB search
MAVTNVAELNALVARVKKAQREYANFSQEQVDKIFAAAALAAADSRILLAKLAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILGQDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIIGWIDEPSVELSNQ
LMHHPDLNLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASVLMSKTF
DNGVICASEQSIIVVDSAYNAVRERFASHGGYMLQGKELKAVSDIILKNGGLNAAIVGQP
AVKIAEMAGIKVPANTKVLIGEVTIVDESEPFAHEKLSPTLAMYRAKNFEDAVAKAEKLV
EMGGIGHTSCLYTDQDNQPERVNYFGNKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRFLFNNGYADQITSVLKGHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVLYEHPNTQFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKENLPASYKDGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLGAPGDRTAQKIQKLLTWLDEIKAELGIPTSIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQILMDTYYGREYSEDVAEEVAAPAPKAEKKTSKK
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacaaatgtcgctgaactaaacgcactcgttgctcgggtcaagaaggcacag
cgcgaatatgccaacttcagtcaagagcaagtcgataagattttcgctgccgccgccctg
gctgctgccgattctcgaattctgctggcaaaactggctgttgaagaatccggaatgggt
attgttgaagacaaagtgatcaaaaaccacttcgcttctgaatacatttacaatgcttac
aaagatgaaaaaacctgtggcatcctgggccaggatgacaccttcggtaccatcactatc
gccgagccaattggtctgatttgcggtatcgttccgactaccaacccaacttctactgca
attttcaaggcgcttatcagcctgaaaacccgtaacggcatcatcttctccccacaccca
cgtgctaaaaatgcaacgaacaaagctgcggatatcgtcctgcaagccgccatcgctgcg
ggtgcgccaaaagatatcattggctggattgatgaaccaagcgtagagctttccaaccaa
ctgatgcaccacccggatctgaacctgattctggcaacaggtggtccgggcatggttaaa
gcagcttatagctccggtaaaccagcaatcggcgtgggtgcaggtaatacaccagtcgtt
gttgatgaaaccgcagatatcaaacgtgttgttgcttccgtcctgatgtctaaaaccttc
gataacggtgtcatctgtgcctctgagcagtccatcatcgtagttgattcagcttataat
gcagtccgtgaacgtttcgcttctcacggcggctacatgctgcagggtaaagaactcaaa
gccgtttcagatatcattctgaaaaatggcggcctcaacgccgctatcgtaggtcagcca
gcagtgaaaattgctgaaatggctggcattaaagtgcctgcgaatactaaagtgctcatc
ggtgaagtcaccattgttgacgaatctgaaccatttgcgcatgaaaaactgtcccctacc
ctcgctatgtaccgcgctaagaatttcgaagacgccgtcgctaaagcagagaaactggta
gaaatgggcggtatcggccatacctcttgcctgtatacagatcaggacaaccaaccagaa
cgtgtgaattattttggcaacaaaatgaaaaccgcacgtattctgatcaacaccccggct
tcacagggtggtatcggtgatctgtacaacttcaaacttgctccgtctctgacgctgggt
tgcggttcctggggtggtaactccatctctgaaaacgtcggtcctaaacacttgatcaac
aagaaaactgtagcgaagcgagcagaaaacatgttgtggcataaacttcctaaatctatc
tacttccgtcgtggctcactgccaatcgcactggaagaagtggcgactgatggagcaaaa
cgcgccttcatcgtaactgaccgcttcctgttcaataacggctatgccgatcagatcacc
agcgttctgaaaggtcatggtattgaaactgaagtattcttcgaagttgaagctgacccg
acgctgagcattgttcgtaaaggtgctgagcagatgaactccttcaaaccagacgttatc
atcgcgctgggtggtggttcaccaatggatgctgcgaagattatgtgggttctgtatgaa
cacccgaatactcagttcgaagatttggcgctgcgttttatggatatccgtaaacgtatc
tacaaattcccgaaaatgggcgtaaaagcgaaaatgatcgccgtcacgaccacttccggt
actggttcagaagttacaccatttgccgttgttactgacgatgcgactggccagaaatac
ccactggctgactatgctctgacacctgacatggctatcgttgacgccaatcttgtcatg
aacatgccgaaatcactgtgtgccttcggtggtctggatgccgtcactcacgcactggaa
gcttatgtttctgtactggcgaacgaatactccgacggtcaggctctgcaggcgctgaaa
ctgctgaaagaaaacctgccagccagctacaaagatggcgctaaaaacccggttgcccgt
gaacgtgttcacaatgcggcgactatcgcgggtatcgcgtttgctaacgccttccttggg
gtttgtcactcaatggcccacaaactgggttcagagttccacattccgcacggtctggct
aacgccatgctgatttcaaacgttatccgttataacgccaacgataacccaacgaaacag
acggctttcagtcagtatgaccgtccgcaagcgcgtcgtcgttacgcagaaattgcagac
catttaggtctgggcgctcctggtgaccgtactgcacagaaaatccagaaactgctgacc
tggttagatgaaatcaaagcggaactgggtatcccaacctctattcgtgaagctggtgtt
caggaagctgacttcctggctaaagtagacaaactgtctgaagatgcgtttgatgaccag
tgtaccggtgctaacccacgttacccgctgatcgccgaattgaaacagattctgatggat
acttactacggccgtgaatacagtgaagacgtagcagaagaagttgctgctcctgcgcca
aaagctgaaaagaaaaccagcaaaaaataa

DBGET integrated database retrieval system