KEGG   Rahnella sp. Y9602: Rahaq_2826Help
Entry
Rahaq_2826        CDS       T01422                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00480  Glutathione metabolism
rah00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rahaq_2826
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rahaq_2826
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rahaq_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADW74429
JGI: Rahaq_2826
UniProt: A0A0H3FC33
Position
complement(3071629..3072180)
Genome map
AA seq 183 aa AA seqDB search
MSNEIYNISLKTIDGETTTLGAYKGSVLLVVNVASQCGLTRQYEGLENIYQAWHDRGFEV
LGFPCNEFGAQEPGTEDEIKTFCTTHFGVKFPMFSKINVNGDNRHPLYSALIAACPTAVK
PEDSAFYERLASKGRQPLKPDDILWNFEKFLIGRDGTVVQRFAPDMTPEDPILMETIKAA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaaatttataatatctccctgaaaactatcgatggcgaaaccacgacgctc
ggtgcttataaaggttctgtattgctggtcgtgaatgtggcatcacaatgtggcctgacc
aggcaatatgaggggctggaaaatatctaccaggcctggcacgatcgtggttttgaagtg
ctggggttcccgtgcaatgaattcggcgcgcaggaaccgggcactgaagatgagatcaaa
accttctgcaccacccattttggcgtgaaattcccgatgtttagcaaaattaacgtcaac
ggagacaaccgtcatccgctgtattcagcgctgattgcagcctgtccgacagccgtcaaa
ccggaagacagtgcgttctacgaacgtctggccagcaaaggtcgtcaacctcttaagccc
gatgacatcttgtggaactttgagaaattcctgattggtcgtgacggcaccgtggttcag
cgttttgcacccgatatgacaccggaagatccgatccttatggaaaccatcaaagccgca
ctggcgaaataa

DBGET integrated database retrieval system