KEGG   Rahnella sp. Y9602: Rahaq_3032Help
Entry
Rahaq_3032        CDS       T01422                                 

Definition
inner-membrane translocator
Orthology
K02057  
simple sugar transport system permease protein
Organism
rah  Rahnella sp. Y9602
Module
Putative simple sugar transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3286835..3287845
Genome map
AA seq 336 aa AA seqDB search
MNKAVVSKENVPDARQPWRHQLFEFLYKWGMLLTVVLLIAAFGLASDNFLEPSNIINILR
SIAIVTVIAIGVSISLAVGGFDLSVGSTASLANALVISMFVWHGFGTTEAILITLALCTL
VGLFNAFLIVILKIPDMLATLASLFVIQGAAMTYSYGGSITENMLLPSGDMAEGTVPAVF
SLLGQVPVIVIVMAVVTIAVQLFMSLTKHGRRMYAIGGNPLAARLAGIRTARYRVIAYVM
SSVLAGAGGILLASRIGSSQVNAGGGYLMDAVAAAYIGFSLAGSGKPNALGTLLGAVILG
VLSNGLVMLSVPYYAMDIIKGLVLAVALALTYIQKR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaagccgtggtgagtaaagaaaacgtgcccgatgcccgccagccgtggcgtcat
cagctgttcgaatttttatataaatggggcatgttgctgaccgtggtgttgctgatcgcc
gcttttggtctggcgtcagataacttcctcgaaccgtcgaacatcatcaatatcttgcgt
tcgattgccatcgtgacggtgattgccatcggcgtgtcgatttccctggcggtcggcggc
ttcgatttatcggtcggctccacggcatcgcttgccaatgcgctggtgatttcgatgttc
gtctggcacggtttcggcacgaccgaagcgatacttatcacgctggcgttgtgcacgctg
gtcggcctgttcaacgcctttctgatcgtcatcctgaaaattcctgacatgctggcaacg
ctcgccagtctgtttgtgattcagggcgcagcgatgacttacagctacggcggttccatc
actgaaaacatgttattgccgagcggcgacatggccgaaggcacggtacctgcggtgttc
agcctgctcggtcaggtgccggtgattgtgatcgtgatggccgtcgtgaccattgcggtg
caactgtttatgtcgctgaccaagcatggccgccgcatgtacgccatcggcggaaatccg
ctggccgcacgtctggcggggatccgcaccgcgcgctaccgcgtgattgcttatgtgatg
tcatccgtgcttgccggtgcaggcgggattttgctggcttcacgcatcggttcttcgcag
gtgaatgccggtggcggctatctgatggatgccgttgccgccgcttatatcggtttctcg
ctggcgggttccggtaaaccgaatgcgctgggaaccttgctgggcgcggtgattttaggc
gtgctgtcgaacgggctggtgatgttgtcggtgccgtattatgcgatggatatcatcaaa
gggttagtgctggcagtggcgttagcgctgacgtatatccagaagagatag

DBGET integrated database retrieval system