KEGG   Rahnella sp. Y9602: Rahaq_3032Help
Entry
Rahaq_3032        CDS       T01422                                 

Definition
inner-membrane translocator
Orthology
K02057  
simple sugar transport system permease protein
Organism
rah  Rahnella sp. Y9602
Module
Putative simple sugar transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3286835..3287845
Genome map
AA seq 336 aa AA seqDB search
MNKAVVSKENVPDARQPWRHQLFEFLYKWGMLLTVVLLIAAFGLASDNFLEPSNIINILR
SIAIVTVIAIGVSISLAVGGFDLSVGSTASLANALVISMFVWHGFGTTEAILITLALCTL
VGLFNAFLIVILKIPDMLATLASLFVIQGAAMTYSYGGSITENMLLPSGDMAEGTVPAVF
SLLGQVPVIVIVMAVVTIAVQLFMSLTKHGRRMYAIGGNPLAARLAGIRTARYRVIAYVM
SSVLAGAGGILLASRIGSSQVNAGGGYLMDAVAAAYIGFSLAGSGKPNALGTLLGAVILG
VLSNGLVMLSVPYYAMDIIKGLVLAVALALTYIQKR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaagccgtggtgagtaaagaaaacgtgcccgatgcccgccagccgtggcgtcat
cagctgttcgaatttttatataaatggggcatgttgctgaccgtggtgttgctgatcgcc
gcttttggtctggcgtcagataacttcctcgaaccgtcgaacatcatcaatatcttgcgt
tcgattgccatcgtgacggtgattgccatcggcgtgtcgatttccctggcggtcggcggc
ttcgatttatcggtcggctccacggcatcgcttgccaatgcgctggtgatttcgatgttc
gtctggcacggtttcggcacgaccgaagcgatacttatcacgctggcgttgtgcacgctg
gtcggcctgttcaacgcctttctgatcgtcatcctgaaaattcctgacatgctggcaacg
ctcgccagtctgtttgtgattcagggcgcagcgatgacttacagctacggcggttccatc
actgaaaacatgttattgccgagcggcgacatggccgaaggcacggtacctgcggtgttc
agcctgctcggtcaggtgccggtgattgtgatcgtgatggccgtcgtgaccattgcggtg
caactgtttatgtcgctgaccaagcatggccgccgcatgtacgccatcggcggaaatccg
ctggccgcacgtctggcggggatccgcaccgcgcgctaccgcgtgattgcttatgtgatg
tcatccgtgcttgccggtgcaggcgggattttgctggcttcacgcatcggttcttcgcag
gtgaatgccggtggcggctatctgatggatgccgttgccgccgcttatatcggtttctcg
ctggcgggttccggtaaaccgaatgcgctgggaaccttgctgggcgcggtgattttaggc
gtgctgtcgaacgggctggtgatgttgtcggtgccgtattatgcgatggatatcatcaaa
gggttagtgctggcagtggcgttagcgctgacgtatatccagaagagatag

DBGET integrated database retrieval system