KEGG   Rahnella sp. Y9602: Rahaq_3106Help
Entry
Rahaq_3106        CDS       T01422                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rah  Rahnella sp. Y9602
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rahaq_3106
   00500 Starch and sucrose metabolism
    Rahaq_3106
Enzymes [BR:rah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Rahaq_3106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3359015..3360295
Genome map
AA seq 426 aa AA seqDB search
MKISTLSRACAMLSASLILAACSSSHQGLSSQVAPGTASLPVLSADEAANFTTKNYLAFG
GPSLQVQQQGWFPKLASTDGVNTHFVVGPQLGTDGAEYSNVQMAVNAALAVRNHGERIFI
KILPGTYNGAVYIPAGSPPVTLFGAGNSSADVTLAQGLEAAAAPATYRSTVSPNGQFLPG
DRAFYMFQNCATLTTETIGTGCTATVWSQSNGVQIQNLTIGNSLLDTVDGGDHSAVALRT
DGDNVILDNVRLIGRQNTFMVNTANIHNQTDNSRYSRAYVHNSLIVGDVDYVFGRANAVF
DHVEFHTVSSRGVKQASVFAPNTPAAAPYGFLVIDSNLTGDRGFEQAAKAKMGRAWDADG
ASSQLVIRDSSFDNSYDQMNPWGASVFSGQPFAGNVPKDEKQQRNLNDTNFNRLWQYNNV
LTQPAK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatttccaccctgtcgcgcgcgtgcgctatgttgtctgccagcctgatcctggcg
gcatgcagcagcagccatcaaggcttatccagccaggttgctccgggcaccgcgtcactg
cccgtgttatcagcggacgaagcggccaattttacaacgaaaaattatctggcctttggc
ggcccttctttgcaggttcagcaacagggctggttccctaaactggccagcactgacggt
gtgaacacccatttcgtggtcggcccgcagttaggcaccgacggcgcagaatactctaac
gttcagatggcggtaaacgcggcactggctgtgcgtaaccacggtgaacgtatcttcatt
aaaatcctgccaggcacttacaacggcgccgtgtacatcccggcgggttcaccaccggtc
accttattcggtgcgggcaacagctctgctgatgtgaccctcgcacaaggtctggaagcc
gcagcggcacccgccacttaccgttcaacagtcagtcctaacggccagttcctgccgggc
gatcgcgcgttctatatgttccagaactgcgccaccctgaccactgaaaccatcggcacc
ggctgtaccgcgaccgtgtggtcacaaagcaacggtgtgcagattcagaacctgaccatc
ggcaattccctgctcgatactgttgacgggggcgatcattccgccgttgcgctgcgtacc
gacggtgacaatgtgattctggataacgtgcgcctgattggccgccagaatacctttatg
gtgaacaccgccaacatccacaaccagactgacaacagccgttacagccgtgcatacgtg
cataacagcctgatcgtgggtgatgtggattacgtatttggccgggcgaatgccgtcttt
gaccacgttgaattccacaccgtcagcagccgtggcgtgaaacaggcgtctgtctttgcg
ccaaacacgccagcagctgcaccgtatggcttcctggtgatcgacagcaacctgaccggc
gaccgtggcttcgagcaggctgcgaaagcgaaaatggggcgtgcgtgggatgctgatggc
gcaagcagccagctggtaatccgcgacagcagcttcgacaacagctatgaccagatgaat
ccgtggggcgcttctgtcttctccggccagccatttgccggcaacgtgccaaaagatgag
aaacaacagcgcaatctgaatgacactaacttcaaccgcctgtggcagtacaacaacgtg
ctgacacagcctgcgaagtaa

DBGET integrated database retrieval system