KEGG   Rahnella sp. Y9602: Rahaq_3125Help
Entry
Rahaq_3125        CDS       T01422                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq_3125
   01230 Biosynthesis of amino acids
    Rahaq_3125
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_3125
  Energy metabolism
   00680 Methane metabolism
    Rahaq_3125
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rahaq_3125
Enzymes [BR:rah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rahaq_3125
Exosome [BR:rah04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rahaq_3125
  Exosomal proteins of melanoma cells
   Rahaq_3125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
3377532..3378284
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWHDVELSDKGRTEAKAAGQLLKDEGFQFDFAYTSVL
KRAIHTLWSVLDELNQPWLPVEKSWKLNERHYGALQGLDKAETAQKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYAKLTAAELPTTESLALTIERVIPYWTEVIKPRIASGERVI
IAAHGNSLRALVKYLDDLSEEEILELNIPTGVPLVYEFDENYKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaagctggtgctggtaagacacggtgagagtgagtggaataaagaaaac
cgctttaccggttggcatgatgttgaactgtccgataagggccgcaccgaagcaaaagct
gctggtcagctgctgaaagacgaaggcttccaattcgattttgcatacacctctgtgctg
aaacgtgccatccacacactgtggagcgttttggacgaactgaaccagccatggctgcca
gttgagaaatcctggaaactgaacgaacgtcattacggtgcgttgcagggtctggataaa
gcagaaactgcacagaaatacggtgacgagcaagttaaacaatggcgtcgtggttttgct
gtgacgccaccagaactggatcgcgctgacgaacgtttccctggccacgacccacgttac
gctaaactgaccgcggcagaactgccaacgacagaaagcctggcgctgaccatcgaacgc
gtcatcccttactggactgaagtgatcaaaccacgcatcgccagcggcgagcgcgtcatc
atcgcggcacacggtaattccctgcgcgcactggttaaatatctcgacgacctgagcgaa
gaagaaattctggaactgaacatccctaccggtgttccactggtttacgagtttgacgaa
aactacaaaccaatcaaacgttactatctgggtaatgccgacgaaatcgcagcgaaagca
gcggccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system