KEGG   Rahnella sp. Y9602: Rahaq_3125Help
Entry
Rahaq_3125        CDS       T01422                                 

Definition
phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq_3125
   01230 Biosynthesis of amino acids
    Rahaq_3125
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_3125
  Energy metabolism
   00680 Methane metabolism
    Rahaq_3125
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rahaq_3125
Enzymes [BR:rah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rahaq_3125
Exosome [BR:rah04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rahaq_3125
  Exosomal proteins of melanoma cells
   Rahaq_3125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3377532..3378284
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWHDVELSDKGRTEAKAAGQLLKDEGFQFDFAYTSVL
KRAIHTLWSVLDELNQPWLPVEKSWKLNERHYGALQGLDKAETAQKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYAKLTAAELPTTESLALTIERVIPYWTEVIKPRIASGERVI
IAAHGNSLRALVKYLDDLSEEEILELNIPTGVPLVYEFDENYKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaagctggtgctggtaagacacggtgagagtgagtggaataaagaaaac
cgctttaccggttggcatgatgttgaactgtccgataagggccgcaccgaagcaaaagct
gctggtcagctgctgaaagacgaaggcttccaattcgattttgcatacacctctgtgctg
aaacgtgccatccacacactgtggagcgttttggacgaactgaaccagccatggctgcca
gttgagaaatcctggaaactgaacgaacgtcattacggtgcgttgcagggtctggataaa
gcagaaactgcacagaaatacggtgacgagcaagttaaacaatggcgtcgtggttttgct
gtgacgccaccagaactggatcgcgctgacgaacgtttccctggccacgacccacgttac
gctaaactgaccgcggcagaactgccaacgacagaaagcctggcgctgaccatcgaacgc
gtcatcccttactggactgaagtgatcaaaccacgcatcgccagcggcgagcgcgtcatc
atcgcggcacacggtaattccctgcgcgcactggttaaatatctcgacgacctgagcgaa
gaagaaattctggaactgaacatccctaccggtgttccactggtttacgagtttgacgaa
aactacaaaccaatcaaacgttactatctgggtaatgccgacgaaatcgcagcgaaagca
gcggccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system