KEGG   Rahnella sp. Y9602: Rahaq_3147Help
Entry
Rahaq_3147        CDS       T01422                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00020  Citrate cycle (TCA cycle)
rah00640  Propanoate metabolism
rah00660  C5-Branched dibasic acid metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01120  Microbial metabolism in diverse environments
rah01130  Biosynthesis of antibiotics
rah01200  Carbon metabolism
Module
rah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rahaq_3147
   00640 Propanoate metabolism
    Rahaq_3147
   00660 C5-Branched dibasic acid metabolism
    Rahaq_3147
Enzymes [BR:rah01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rahaq_3147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A BAT
Motif
Other DBs
NCBI-ProteinID: ADW74741
JGI: Rahaq_3147
UniProt: A0A0H3FD83
Position
complement(3397161..3398327)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFLRYGLPAPTGFACSTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDASGQPVNQILVEAATDIDQELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLAGPQPYQGRELAFKLGLTGKQVQQFTKI
FMGLANIFLERDLALIEINPLVVTTAGDLICLDGKLGADGNALFRQPELREMRDYSQEDA
RESQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDEKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVSVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTNAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcgaaacagctgttcctgcgctacggcctgccagcaccg
acgggcttcgcctgttccaccccgcgtgaagcggaagaggctgcatcgaaaatcggtgcc
ggtccgtgggtggtgaaatgtcaggttcatgccggtggccgcggtaaagcgggcggcgtg
aaagtggtcaaaagcaaagaagagatccgcgcttttgctgagcactggctgggtaaacgt
ctggtcacttaccagacagacgccagcggtcagccggttaaccagatcctggttgaagcg
gcaacggatatcgatcaggaactgtacctcggtgcggtagtggatcgcagctcccgtcgc
gtggtgttcatggcatctacagaaggcggcgtggaaattgagaaagtggcagaagagacg
ccacacctgatccataaagtggcactggatccgctggcaggtccgcagccttatcaggga
cgcgaactggctttcaaactgggcctgaccggtaagcaggttcagcagttcaccaagatc
ttcatgggtctggcgaacatcttccttgagcgcgatctggcgctgatcgaaatcaacccg
ctggtggtgactaccgctggcgacctgatctgcctcgacggcaaactgggtgcagacggc
aacgccttgttccgtcagccagaattgcgcgaaatgcgcgattacagccaggaagatgcc
cgtgaatctcaggcagcgcagtgggaactgaactacgttgcactcgacggcaacatcggt
tgcatggtgaacggtgccggtctggcaatgggtaccatggatatcgtgaaactgcacggt
ggcgaaccggctaacttcctggatgttggcggtggcgcaaccaaagaacgcgtgaccgaa
gccttcaaaatcatcctgtccgatgaaaaagtcaaagctgtcttcgttaacatcttcggc
ggtatcgttcgttgcgacctgatcgccgacggtatcatcggcgcggtggaagaagtgggt
gtcagcgtaccggttgtggtgcgtcttgaaggtaacaatgccgagctgggtgccaaaaaa
ctggcagacagcggtttgaacatcattgcagcgaccagcctgacgaatgcggctcaacaa
gttgtcgcggcagtggaggggaaataa

DBGET integrated database retrieval system