KEGG   Rahnella sp. Y9602: Rahaq_3188Help
Entry
Rahaq_3188        CDS       T01422                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rah  Rahnella sp. Y9602
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rahaq_3188
Enzymes [BR:rah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rahaq_3188
Peptidases [BR:rah01002]
 Cysteine Peptidases
  Family C44
   Rahaq_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3449120..3450784
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDIKTDAVELRKKALELSRLMRHRGPDWSGVFASDKAILSHERLSIVDVNNGA
QPLYNAAHTHVLAVNGEIYNHQALRAELGDKYEFQTASDCEVILALYQEKGPAFLDELQG
MFAFILYDTEKDAYLIGRDHLGIIPLYMGYDEHGNMYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYQRDWFDFENVKDNVTDAAALKDALEEAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAGRRIEDKDQSEAWWPQLHSFAVGLQGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGADEVLGGYLY
FHKAPNAKEFHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPKD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEVASQQITDQQLET
AHFRFPYNTPTSKEGYLYRTIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKNMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaattttcggtgtgctcgatatcaaaactgacgctgtcgagctgcgcaaaaaa
gcgctggaactgtcgcgcctgatgcgtcaccgcggacccgactggtccggtgtgtttgcc
agcgataaagccattctgtcgcatgagcgtctgtccattgtcgacgtgaacaacggcgca
caacctttgtacaacgcagcacacacccacgttctggctgtgaacggcgaaatttacaac
catcaggcattgcgcgcagaactgggcgacaagtatgaattccagaccgcatctgactgt
gaagtcattctggcgctgtatcaggaaaaaggccctgccttcctcgatgaactgcaaggt
atgttcgcctttattctgtatgacacagaaaaagacgcgtacctgattggccgcgaccat
ctgggcattatcccgctgtacatgggctacgacgaacacggcaacatgtacgtcgcttca
gaaatgaaagcgctggtgccggtttgtcgcaccatcaaagaattcccggcaggcagctat
ctgtggagccaggacggtgaaattcgcgaatactaccagcgtgactggtttgacttcgaa
aacgtcaaagacaatgtgaccgacgctgcggcgctgaaagatgcactggaagaagcggta
aaaagtcacctgatgtctgacgtgccttacggcgtgctgctgtccggtggtctggattcc
tccgtgatttccgccatcaccaagaaatttgccggccgccgtatcgaagataaagatcag
agcgaagcctggtggccgcaactgcactcctttgccgtcggtctgcaaggttcaccggac
ctgcgcgctgctcaggaagtcgccaaccatttaggcaccgtgcaccacgaaattcacttc
accgtgcaggaaggtctggatgctatccgcgatgttatctatcacattgaaacgtatgac
gtcacgactatccgcgcatcaacaccgatgtatctgatgtcgcgtaaaatcaaagcgatg
ggcatcaaaatggtgttgtctggcgaaggcgcagacgaagtgttgggcggctacctgtat
ttccataaagcgccaaacgccaaagaatttcatgaagaaaccgtgcgtaaattgctggcc
ctgcatatgtatgactgtgcgcgtgccaacaaagccatgtcagcctggggtgtggaagcc
cgcgtcccgttcctggacaaaaaattcctcgacgtcgcgatgcgtatcaacccgaaagac
aagatgtgcggcaacggcaagatggagaaacatatcctgcgtgaatgtttcgagtcttat
ttgccacacagcgtggcctggcgccagaaagaacagttctctgatggcgtaggttacagc
tggatcgataccttaaaagaagtggcctctcagcagatcaccgatcaacagcttgaaact
gcacatttccgtttcccgtacaacacgccgacctcgaaagaaggctacctgtaccgtacg
atttttgaagagttattcccggtgccaagcgcggctgaatgtgtgcctggcgggccgtca
gtggcctgttcttcagcgaaagctattgaatgggacgaagcgttcaaaaacatggacgat
ccttctggccgtgccgttggcgtgcatcagtccgcttataaataa

DBGET integrated database retrieval system