KEGG   Rahnella sp. Y9602: Rahaq_3294Help
Entry
Rahaq_3294        CDS       T01422                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rah  Rahnella sp. Y9602
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rah01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3563180..3563767
Genome map
AA seq 195 aa AA seqDB search
MLLGLLSFRAVAADNLLIIGDSLSAVYRLPVAESWPTLLNNTWQKEGGKPTIINASISGD
TAEQGLARLPSLLQQHHPRWVLIELGANDGLRGFPPQTLSRTLQQVIEQVKQSNAQPLLM
QIRLPPNYGRRYGDAFYAIYPALAKQENIPLVPFFMEQVAVKPEWMQDDGLHPALAAQSF
IAGWMSEKLTPLLTH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaggattattgagttttcgcgccgttgctgctgataacttgctgattattggc
gacagtttgagtgcagtctatcgccttccggtagccgaatcctggccgacattactgaat
aacacatggcaaaaagaaggtggtaagcccaccataattaacgccagtatcagcggcgat
accgctgaacaagggctggcacgcctgccatccttgctgcaacaacatcacccccgctgg
gtgctgattgaactgggcgccaacgacggattgcggggtttcccgccacaaaccctttcc
cggacgctgcaacaggtgattgaacaggtaaaacagagcaatgcccaaccgttgctgatg
caaatccgtctgccacccaattatggccgccgctacggcgacgcgttctacgccatttat
ccggcgctggcaaagcaggaaaacatcccgctggtgccgttctttatggagcaggtcgcc
gtgaaacctgaatggatgcaggacgacggtttacatcctgcgctggcagcacaatcgttt
attgccggatggatgtcagaaaaactcacgccgctgctgacgcattag

DBGET integrated database retrieval system