KEGG   Rahnella sp. Y9602: Rahaq_3294Help
Entry
Rahaq_3294        CDS       T01422                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rah  Rahnella sp. Y9602
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rahaq_3294
Enzymes [BR:rah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rahaq_3294
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rahaq_3294
Lipid biosynthesis proteins [BR:rah01004]
 Fatty acid synthase
  Component type
   Rahaq_3294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3563180..3563767
Genome map
AA seq 195 aa AA seqDB search
MLLGLLSFRAVAADNLLIIGDSLSAVYRLPVAESWPTLLNNTWQKEGGKPTIINASISGD
TAEQGLARLPSLLQQHHPRWVLIELGANDGLRGFPPQTLSRTLQQVIEQVKQSNAQPLLM
QIRLPPNYGRRYGDAFYAIYPALAKQENIPLVPFFMEQVAVKPEWMQDDGLHPALAAQSF
IAGWMSEKLTPLLTH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaggattattgagttttcgcgccgttgctgctgataacttgctgattattggc
gacagtttgagtgcagtctatcgccttccggtagccgaatcctggccgacattactgaat
aacacatggcaaaaagaaggtggtaagcccaccataattaacgccagtatcagcggcgat
accgctgaacaagggctggcacgcctgccatccttgctgcaacaacatcacccccgctgg
gtgctgattgaactgggcgccaacgacggattgcggggtttcccgccacaaaccctttcc
cggacgctgcaacaggtgattgaacaggtaaaacagagcaatgcccaaccgttgctgatg
caaatccgtctgccacccaattatggccgccgctacggcgacgcgttctacgccatttat
ccggcgctggcaaagcaggaaaacatcccgctggtgccgttctttatggagcaggtcgcc
gtgaaacctgaatggatgcaggacgacggtttacatcctgcgctggcagcacaatcgttt
attgccggatggatgtcagaaaaactcacgccgctgctgacgcattag

DBGET integrated database retrieval system