KEGG   Rahnella sp. Y9602: Rahaq_3665Help
Entry
Rahaq_3665        CDS       T01422                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rah  Rahnella sp. Y9602
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rahaq_3665
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rahaq_3665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3976016..3976495
Genome map
AA seq 159 aa AA seqDB search
MIRVYLALGSNLARPLDQVNCALEALAHLPRTRFVAASPFYRSKPLGPQDQPDYLNAVVA
LDTLLPPEELLDCTQGIEQNQGRVRKAERWGPRTLDLDMLIYGDQVINTERLTVPHYDMK
NREFMLYPLADLAPELVFPDGETLQTLLARVPLNGLTKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgtttacctggctctgggcagtaatcttgcccgtccgcttgaccaggtaaac
tgtgcgctggaggcgctggcacatttgccgcgcacccgctttgtggccgcatccccgttt
taccgcagtaaaccgctggggccacaggatcaacctgattatctgaatgctgtggtggcg
ctcgatacgctgctgccgccggaagagttgctcgattgcacacaagggatcgagcaaaat
cagggacgcgtccgcaaagccgaacgctgggggccgcggacgttagatcttgatatgctg
atttatggcgatcaggtgatcaacaccgagcgtttaacggtgccgcattacgacatgaaa
aaccgcgaattcatgctgtatccgctggccgatctggcaccagaactggtgttccctgac
ggcgaaaccttgcaaactctgctcgcccgcgtgccgcttaacggtctgaccaaatggtaa

DBGET integrated database retrieval system