KEGG   Rahnella sp. Y9602: Rahaq_3704Help
Entry
Rahaq_3704        CDS       T01422                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00010  Glycolysis / Gluconeogenesis
rah00020  Citrate cycle (TCA cycle)
rah00620  Pyruvate metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01120  Microbial metabolism in diverse environments
rah01130  Biosynthesis of antibiotics
rah01200  Carbon metabolism
Module
rah_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_3704
   00020 Citrate cycle (TCA cycle)
    Rahaq_3704
   00620 Pyruvate metabolism
    Rahaq_3704
Enzymes [BR:rah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rahaq_3704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223
Motif
Other DBs
NCBI-ProteinID: ADW75293
JGI: Rahaq_3704
UniProt: A0A0H3FGR5
Position
complement(4014513..4016408)
Genome map
AA seq 631 aa AA seqDB search
MAIEINVPDIGADAVEVTEIMVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVA
VGDTVETGKLIMIFDAADGAADAAPAKQEAKAEEKPAAAAPASSESKEVNVPDIGGDEVE
VTEIMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGKVKEIKIAAGDKVSTGSLIMVFEV
AGSGAAAPAAAAETQSDAAPAAAAQSGSKEVNVPDIGGDEVEVTEIMVKVGDKISAEQSL
ITVEGDKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMVFEVEGAAPAAPAAKKEEAAAP
AKQEQKAAAPAVKAESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILRED
VQTYVKDAVKRAEAAPAAATGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRN
WVMIPHVTHFDKTDITELEAFRKQQNDEAAKRKLDVKFTPVVFIMKAVAAALEQMPRFNS
SLSEDGQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIAELSRELMAISKKARDGKLT
AGEMQGGCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSAIEPVWNGKEFTPRLMMPMSL
SFDHRVIDGADGARFITIINNVLSDIRRLVM
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaattaacgtaccggacatcggtgcagatgcagtggaagtcaccgaaatt
atggtgaaggtgggcgataaagttgaagcagaacaatcgctgatcaccgtagaaggcgat
aaagcttctatggaagtgccttctccacaagctggcgtggtcaaagaaattaaagttgcg
gtcggcgataccgtcgaaaccggcaaactgatcatgatctttgacgccgctgacggtgct
gctgatgcagcacctgcgaaacaggaagccaaagcagaagagaaacctgctgctgccgca
cctgcttccagcgaaagcaaagaagtgaacgtacctgatatcggtggcgacgaagttgaa
gtcactgaaatcatggtgaaagtgggcgatacagtagaagcggaacaatcgctgatcacc
gtagaaggcgacaaagcctctatggaagtccctgcgccgttcgcgggcaaagtgaaagaa
atcaaaatcgctgcgggcgacaaagtcagcaccggttccctgatcatggtcttcgaagtg
gcaggttctggtgcagccgcacctgccgcagcagcagaaacccaatcagacgcggcacct
gcggctgcggctcagtccggcagcaaagaagtgaacgtgcctgatatcggtggcgacgaa
gttgaagtcactgaaatcatggtgaaagtgggcgacaaaatcagtgcagaacagtcactg
attaccgttgaaggcgacaaagcctcaatggaagtcccggctccgttcgcgggtaccgtg
aaagaaatcaaaattgctgcgggcgacaaagtcagcaccggctctctgatcatggtcttc
gaagtagaaggcgctgcgcctgctgctccggcggctaagaaagaagaagcggctgccccg
gcgaaacaggaacaaaaagccgctgctcctgctgttaaagctgaaagcaaaggcgaattc
gcagagaacgatgcttacgttcacgccacgccggttatccgtcgtctggcccgtgaattc
ggcgttaacctggcgaaagtcaaaggcactggccgtaaaggtcgcatcctgcgtgaagac
gtacagacttacgtgaaagacgcggtcaaacgtgctgaagccgcgccggcagcagcaacg
ggtggcggtctgccgggcatgttgccttggccgaaagtggacttcagcaagttcggtgag
attgaagaagttgaactgggccgtatccagaaaatctctggtgcgaacctgagccgtaac
tgggtgatgatcccgcacgttacgcacttcgacaaaactgatatcactgagctggaagcg
ttccgtaaacagcagaacgatgaagccgctaaacgcaaactggacgtgaaattcaccccg
gtggtcttcatcatgaaagccgttgccgctgcccttgagcagatgccacgcttcaacagt
tccctgtccgaagatggtcagaaactgacgctgaaaaaatacatcaacatcggtgtggcg
gttgatacgccaaacggtctggttgttccggtcttcaaagacgtgaacaagaaaggcatc
gccgagttgtcccgtgagctgatggctatctccaagaaagcccgtgacggtaagctgact
gctggcgaaatgcagggcggttgcttcactatctccagcctcgggggtatcgggacgacc
cacttcgcgccaatcgttaatgcgccggaagtggctatcctcggtgtttccaagtctgcc
attgagccagtctggaacggcaaagagttcacaccgcgtctgatgatgccaatgtcgctc
tccttcgaccaccgagtcattgacggtgccgatggtgcgcgcttcatcaccatcatcaac
aacgtgttgtcagacattcgccgcctggtgatgtaa

DBGET integrated database retrieval system