KEGG   Rahnella sp. Y9602: Rahaq_3736Help
Entry
Rahaq_3736        CDS       T01422                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00300  Lysine biosynthesis
rah00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rahaq_3736
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rahaq_3736
Enzymes [BR:rah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Rahaq_3736
Peptidoglycan biosynthesis and degradation proteins [BR:rah01011]
 Precursor biosynthesis
  Amino acid ligase
   Rahaq_3736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ADW75325
JGI: Rahaq_3736
UniProt: A0A0H3FK03
Position
complement(4052085..4053572)
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDILAPWVSDAPAVALKDMILDSRVAAAGDLFVAVSGHTSDGRRFIPQAIAQGV
AAVVAEAKGEQQHGTVCQMHGVPVVYLEDLNILLSELAGRFYQQPGKELRLVGVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLDNVIPAENTTGSAVQVQHILADLVKLGATFA
AMEVSSHGLVQHRVAALPFAAAAFTNLSRDHLDYHGDMQSYEDAKWQLFASHQVGQKIIN
ADDEVGARWLAKTPNAIAVSMEDKIPAGWSGRWLVARSVNYHDNGATVNIDSSWGEGKLE
SRLMGAFNVSNLLVALATLLSLDYPLAQLLATASQLQPVCGRMEVFNAPGKPTAVVDYAH
TPDALEKALAAARLHCRGTLWCVFGCGGDRDKGKRPLMGAIAEQYADRVIVTDDNPRSEE
PRAIVADILAGLLDAGRVQEIHGRAEAVTSAIMQAKEDDVVLIAGKGHEDYQLVGNQRLD
YSDRVTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacatcttagcgccctgggtgagtgatgccccggcggta
gcgctaaaagacatgattctggacagccgcgttgcggctgccggcgatctgtttgtcgcg
gtttcaggccataccagtgacgggcgtcgttttattccccaggcaattgcccagggcgtc
gccgccgttgtggccgaggcaaagggtgagcaacagcacggaacggtctgccagatgcat
ggcgtaccggtggtttatcttgaggatctcaatattctgctgtcagagctggcgggacgt
ttttaccagcaaccgggcaaagaattacgtctggttggcgtaactggcaccaacggcaaa
accacgaccacgcaactgctggcgcaatggagccagttgctgggcgaaaccagtgccgtg
atgggcactgtgggcaatggcctgctggataacgtgataccagcggaaaacaccaccggt
tctgccgtacaggttcagcacattctggctgacctggtgaaactgggtgcaacctttgcc
gcaatggaagtttcttcacacgggctggttcagcaccgtgttgccgcactgccgtttgcc
gctgccgcatttaccaacctgagccgtgatcaccttgattaccacggtgatatgcaaagc
tatgaagatgccaaatggcagcttttcgcctcacatcaggtcggtcaaaaaattatcaat
gctgacgatgaagtcggtgcacgctggctggcgaaaacgccaaatgcgattgcggtcagc
atggaagacaaaattccggcaggctggagtggccgctggctggtggcacgtagcgtgaat
tatcacgataatggtgccaccgtaaacatcgattcaagctggggtgaaggcaagctggag
agccgcctgatgggggccttcaacgtcagcaatctgctggttgcgctggccacgctgctt
tctctggattatccgctggcgcaattactggcaaccgcctctcagctgcaaccggtttgt
ggccgtatggaagttttcaatgcgccgggtaaacctacggcggtggttgattatgcgcac
actcctgacgcactggaaaaagcgctggcggcagcgcggctacattgtcgtggcacgttg
tggtgcgtttttggttgcggtggagatcgcgataaaggcaagcgtccgctgatgggcgct
attgctgagcaatacgctgaccgcgtgattgttaccgatgataatcctcgcagcgaagag
cctcgcgctatcgttgcagatatccttgccggtctgcttgatgcaggacgtgtgcaggaa
atccatggacgcgcagaagcagtcaccagcgcgatcatgcaggcgaaagaagacgacgtt
gtgttgattgccggtaaagggcatgaggattaccagctcgtcggaaaccagcgtctcgac
tattccgaccgtgtgacggttgcacgtttgctgggggtgatcgcatga

DBGET integrated database retrieval system