KEGG   Rahnella sp. Y9602: Rahaq_3822Help
Entry
Rahaq_3822        CDS       T01422                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rah  Rahnella sp. Y9602
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rahaq_3822
Enzymes [BR:rah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rahaq_3822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4164892..4166220)
Genome map
AA seq 442 aa AA seqDB search
MFLAQEIIRKKRDGQPLSDEEIRFFVNGIRDSQVSEGQIAALAMTIYFNDMTMNERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDSRFRSIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYQLSEDLAQAIVDVANGAGCKTTALLT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAKDDADARSQL
QAVLDNGKAAEVFGRMIAAQKGPTDFIENYDRYLQQATLSKPVYAEGNGIVSAMDTRALG
MAVVSLGGGRRRASDAIDYSVGLTHMAQLGQQVDTRQPLAMIHANSEAAWQQAAQEVRAA
IVLSDKAPESTSVVYRRIGGNA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctcgcacaagaaattattcgtaaaaaacgtgacggtcagcctttaagcgatgaa
gaaattcgtttctttgttaatggtattcgcgacagtcaggtttcagaaggccagattgcc
gcgctggcaatgactatctatttcaatgatatgaccatgaatgagcgtgtgtcgctgacc
atggcaatgcgcgactccggtaccgtcctggactggaaatcgctcaacctcaacggcccg
atcgttgataaacattcgaccggcggtgtgggtgacgtgacgtccctgatgctggggccg
atggtagcggcatgcggcggttatgtgccgatgatttccggccgcggcctcggtcatacc
ggcggtacgctggataaacttgaagccatcccgggcttcgatattttcccggatgacagc
cgttttcgcagcatcattcaggatgtcggcgtggcaattatcggccagaccagctcgctg
gctccggcggataagcgtttctatgcgacacgtgatatcaccgcaactgtcgattctatc
ccgctgatcactgcttcgattctcgccaaaaaactggccgaagggctggatgcgttagtg
atggacgtcaaagtcggctccggggccttcatgccgacttaccagctatccgaagatctg
gcgcaggcgattgtcgatgtggccaatggcgcaggttgtaaaaccacggcgctgctgacc
gacatgaatcaggtgctggcatccagcgcagggaatgcggtggaagtgcgcgaagccgtg
cgcttcctgacgggtgaataccggaatccgcgtctgctggaagtgacaatggcgctctgt
gttgaaatgctgctgtccggcgggctggcaaaagatgacgccgacgcccgcagtcagttg
caggccgtgctggataacggcaaagccgcagaagtctttggccgcatgattgccgcccag
aaaggcccaaccgatttcatcgagaattacgatcgttatctgcaacaggccacgctgagc
aaaccggtttacgccgaaggcaacgggattgtcagcgcgatggacacccgtgcgctgggc
atggccgtcgtttcactgggtggcggacgtcgccgcgccagcgatgctatcgactacagc
gtcggtctgacccatatggcgcagcttggccagcaagtggatacccgtcagccactggcg
atgatccacgcgaacagtgaagcggcctggcagcaggcggcgcaggaagtgcgtgcggcc
attgtcctgagcgacaaagcgccggaaagcacgtcggtggtttaccgccggatcggtggt
aacgcttga

DBGET integrated database retrieval system