KEGG   Rahnella sp. Y9602: Rahaq_3834Help
Entry
Rahaq_3834        CDS       T01422                                 

Definition
DNA polymerase III psi subunit
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
rah  Rahnella sp. Y9602
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rahaq_3834
   00240 Pyrimidine metabolism
    Rahaq_3834
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Rahaq_3834
   03430 Mismatch repair
    Rahaq_3834
   03440 Homologous recombination
    Rahaq_3834
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Rahaq_3834
DNA replication proteins [BR:rah03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Rahaq_3834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4178316..4178729)
Genome map
AA seq 137 aa AA seqDB search
MASRRDTLLQQLGITQWTLRRPAVLQGEVAVSLPAGTKLLIVAAVPPAEDDPLVSDVLRS
LTLKESEVYRLTPEQVTMLPEDTRCNIWRLGVSEPLTLTGPQLSTPALAELYQDAGAKRA
LWQQICENEQHFYPDAR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagacgagatacattattacaacagctgggcattacccagtggacgctgcgc
cggcctgctgtattacaaggcgaagtggcagtcagtctgcccgcgggaactaaattgctg
atcgtcgccgccgttccgccagcagaagatgatccgctggtcagcgatgttttgcgcagc
ctgacgctaaaagaatcagaagtttaccgcctgacgcctgaacaggtcactatgttacct
gaagatacccgctgcaatatctggcgactgggggtaagcgaaccgctgactctcactggc
ccgcagctctccactccggccctggccgaactctatcaagacgccggcgccaaacgcgcg
ctctggcagcagatctgtgaaaatgaacaacatttctatcctgacgcccgctga

DBGET integrated database retrieval system