KEGG   Rahnella sp. Y9602: Rahaq_3885Help
Entry
Rahaq_3885        CDS       T01422                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
rah  Rahnella sp. Y9602
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rah00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4239986..4241788
Genome map
AA seq 600 aa AA seqDB search
MSSVNLEYVLRLESLLSRIYPREHIADLLKKILHLADKWNYGKHRTTRWVDGTNIYLITY
GDNIRHGEQPPLATLNHFANTYLRDIISDIHILPMYPYSSDDGFSVIDYRRIDEHLGGWS
DIHHLSANFNLMFDCVINHISRSSEWMKGYLHDDPYYKDYFIAANPELDYSRVVRPRASP
LLSPFIKTDGTELYLWTTFSEDQIDINFKNPQVLLESIDVLLQYAASGGQSIRLDAIGYI
WKEAGTRCIHMPQAHNIIKVWRTILDEVIPGTRIITETNVPHHENISYFGEGDEAHMVYQ
FPLPPLTLHAFLRQDTTTLTQWAQSLNAEARYPDTTYFNFLASHDGIGLRPTETFLTDDE
RKYMAQETLRKEGRVSYKDNGDGTHSPYELNINYLSALTEPEDNTEMKARKFLAAQALLL
SFIGVPAIYIHSLLGSENDLDGMHQSGINRRINRKKLDLMDIEAELEKKDGLRARIFYGL
QALIRHRREHPAFSPQAGQRVFDLGKSLFAMERYDPKTEDRISCIFNISDHSQMLKLAVE
GKDLISGEVFNGQMRLQPWQVVWIKHKLKAPERLGRLRRWRMKLIKRTKRYTISIKRTMR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagtcaatcttgagtatgttctgcggctggaaagcctgttaagcaggatttac
ccccgggaacacatcgccgacctgctgaaaaaaatcctgcatctcgccgacaaatggaat
tacggcaaacaccgcaccacccgctgggtggatgggaccaatatttatctgattacttat
ggcgataatatccgtcacggcgagcaaccgccgctggcgacgctcaatcatttcgctaac
acttatctgcgcgacattatcagcgacatccatattctgccgatgtatccgtacagttca
gacgacggcttcagcgtcattgactaccggcggatcgatgaacatcttggcggctggtca
gatattcatcacctttcggccaatttcaacctgatgtttgattgcgtgatcaaccatatt
tcccgctcaagcgaatggatgaaaggctatctgcatgacgatccgtattacaaagattac
tttattgccgctaatcccgagctggattacagccgcgtcgtgcgcccgcgcgcttcgccg
ctgctctcgccatttatcaaaaccgacggcaccgaactgtatctgtggacgacgttcagt
gaagatcagatcgatattaatttcaagaatcctcaggtcttgctggaaagcattgatgtg
ctgttgcaatacgccgccagcggcggacagtcgatccgccttgatgcgattggctatatc
tggaaagaagccgggacgcgctgcattcacatgccacaggcgcataacatcattaaagtc
tggcgcactattctcgatgaagtgatccccggcacgcggatcatcactgaaaccaacgtc
ccgcaccacgaaaatatcagttatttcggcgaaggtgacgaggcacacatggtgtatcag
ttcccgctgccaccgctgaccttgcacgcttttttgcgtcaggacaccaccacgctcacc
caatgggcgcaaagcctgaatgcggaagcccgttaccctgacaccacctatttcaacttc
cttgccagccacgacggcatcggtttacgtccgaccgaaaccttcctgaccgatgacgaa
cgtaaatacatggcgcaggaaacgctgcgcaaggaaggccgcgtgtcctacaaagacaac
ggcgacggcacccattcgccttacgaactgaacattaattacctgagcgcgctgaccgaa
ccggaagataataccgagatgaaagcccgcaagtttctggcggcacaggcgctgttattg
tcgtttatcggcgtcccggcgatttatattcacagcctgctgggcagcgagaacgatctc
gacggcatgcatcagtccgggatcaaccgccgcatcaaccgtaaaaagctggatctgatg
gatattgaagctgaactggaaaaaaaagacggcttacgcgcccgcattttttacggatta
caggcactcatcaggcaccgccgcgagcacccggcattttcaccgcaggctggccagcgc
gtgtttgatctgggcaaatcgctgtttgcgatggaacgctatgatccgaaaaccgaagac
cggatcagctgcatattcaatatcagcgatcattcgcagatgctgaagctggcggtcgaa
gggaaggatctgattagcggagaagtatttaacggccagatgcgtctccagccgtggcag
gtggtgtggatcaaacacaaactcaaagcgccggaacgtctcggcaggctgcgtcgctgg
cggatgaagctgatcaagcgcacaaagcgctacacaataagcattaagcggacaatgcgc
tga

DBGET integrated database retrieval system