KEGG   Rahnella sp. Y9602: Rahaq_3893Help
Entry
Rahaq_3893        CDS       T01422                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rah  Rahnella sp. Y9602
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rahaq_3893
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rahaq_3893
Enzymes [BR:rah01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Rahaq_3893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4248398..4249333
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKDIISINDLSREELELVLDTAASLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSSNTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLDNIKIAMVGDLKYGRTVHSLAQALAKF
NGNRFYFIAPDALAMPGYILTLLEEKGIEYSLHSSIDEVVSEIDILYMTRVQKERLDPSE
YANVKAQFVLRAADLTHAQPHLKVLHPLPRIDEITPDVDKTPYAWYFQQAGNGIFARQAL
LALVLNADTAQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccaatccgctgtatcagaaagacatcatttctatcaacgatctcagccgcgaagag
ctggaactggtactggataccgctgccagcctgaaagccaacccgcagcctgaattgctg
aaacacaaagtgatcgccagttgtttcttcgaagcctcaacccgcacccgtctgtcattt
gaaacgtcgatgcatcgtctgggcgcctcggtggtgggtttctccgacagcagcaacacc
tcgctcggcaaaaaaggcgaaacactggccgataccatttcggtcatcagcacctacgtt
gatgcgattgtgatgcgccatccgcaggaaggcgcggcgcgtctggcgaccgaattctcc
ggcggtattccggtgctcaacgcaggcgacggagcgaaccagcatccgacgcaaaccctg
ctggatttgttcaccattcaggaaactcagggccgtctcgacaacattaaaatcgccatg
gtcggcgacctgaaatatggccgcacggtacattccctggcacaggcactggcgaaattt
aacggcaaccgcttctactttatcgcgccggacgcgctggcgatgccggggtatatcctg
acgttgctggaagagaaaggcatcgaatacagcctgcacagcagcattgatgaagtggtg
tctgaaatcgacattctgtacatgacccgcgtgcaaaaagagcgtctggatccatcggaa
tacgccaacgtgaaagcacagtttgtcctgcgggctgccgatctgacccatgctcagccg
cacctgaaagtgcttcacccgctgccgcgtatcgacgaaatcacgccggatgtggataaa
acgccttatgcctggtatttccagcaggccggtaacggaatttttgcgcgtcaggctttg
ctggcgctggttctgaacgcagacactgcacagtaa

DBGET integrated database retrieval system