KEGG   Rahnella sp. Y9602: Rahaq_4114Help
Entry
Rahaq_4114        CDS       T01422                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rah  Rahnella sp. Y9602
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq_4114
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rahaq_4114
Enzymes [BR:rah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rahaq_4114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4478920..4480242)
Genome map
AA seq 440 aa AA seqDB search
MKTNRTQQIQQLEETWSQPRWKNITRPYTAAEVISLRGSVNPECTLAQHGAARLWNLLHG
ASRKGYVNCLGALTGGQALQQAKAGIEAIYLSGWQVAADANTASSMYPDQSLYPVNSVPE
VVARINNTFRRADQIQWANNIEPGQPGYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLAAVKKCGHMGGKVLVPTQEAVQKLISARLAADVLGVPTLLVARTDADAAD
LLTSDCDPYDSQFITGERTHEGFYRTNAGIEQAISRGLAYAPYADVVWCETSTPDLKLAQ
RFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDKTIASFQDQLAAMGYQYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVDKVQEPEFAAIDRGYTFASHQQEVGTGYFDKVTTIIQGGR
SSVTALTGSTEEQQFSPTSH
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaccgtactcagcaaattcagcagcttgaagaaacgtggagccaaccacgc
tggaaaaatatcacccgaccttacacggcggcagaagtgatcagcctgcggggttcagtc
aatccggagtgtacgctggctcagcacggagctgcccgcctgtggaatttactccacggc
gcatcgcgtaaagggtatgtgaattgcctcggcgcgctgacaggtggccaggccttacaa
caggcaaaagcgggtatcgaagccatttatctctcgggatggcaagttgccgcggatgcc
aatacggcttccagtatgtatcccgaccagtctttgtatcctgtgaattcggtgcctgaa
gttgtggcgcggattaacaacacttttcgtcgcgctgatcagatccagtgggccaataac
attgagcccgggcagcctggctataccgactatttcctgccgattgtggcggacgctgaa
gccggttttggtggcgtactcaatgcctttgaactgatgaaatccatgattgaagccggt
gctgccgccgttcattttgaagatcagcttgctgcggtgaagaagtgcgggcatatgggc
ggcaaagttctggtgccgacacaggaagccgtacagaagctgatttccgcgcgtcttgcc
gccgatgttcttggtgtgccgacgttgttggtggcacgtaccgatgccgatgcggcagat
ttactgacgtcggactgcgacccgtatgacagccagtttattaccggcgaaagaacacat
gaaggtttctaccggacgaacgccggtattgagcaggccatcagtcgcggtctggcgtac
gcaccttatgccgacgtagtgtggtgcgagacatcgacgcctgatctgaaactggctcag
cgttttgctgaggccatccacgctaaattcccgggcaaattgctggcctataactgttcg
ccatcgtttaactggaagaagaatctcgacgataaaaccatcgccagtttccaggaccag
ttggccgcgatgggttaccagtatcagttcattacgctggcgggcattcacagcatgtgg
ttcaacatgttcgatcttgcccatgcttatgcacagggcgaggggatgaagcactacgtg
gataaagtgcaggagccggaatttgcagccatagatcgcggctatacctttgcttctcat
cagcaggaagtcggaaccggctatttcgataaagtcactaccattattcagggcggtcgc
tcctcggttaccgcactcaccggctctaccgaagaacagcagttttctccgacgtcacac
tga

DBGET integrated database retrieval system