KEGG   Rahnella sp. Y9602: Rahaq_4114Help
Entry
Rahaq_4114        CDS       T01422                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00630  Glyoxylate and dicarboxylate metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01120  Microbial metabolism in diverse environments
rah01200  Carbon metabolism
Module
rah_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rahaq_4114
Enzymes [BR:rah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rahaq_4114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADW75702
JGI: Rahaq_4114
UniProt: A0A0H3FL27
Position
complement(4478920..4480242)
Genome map
AA seq 440 aa AA seqDB search
MKTNRTQQIQQLEETWSQPRWKNITRPYTAAEVISLRGSVNPECTLAQHGAARLWNLLHG
ASRKGYVNCLGALTGGQALQQAKAGIEAIYLSGWQVAADANTASSMYPDQSLYPVNSVPE
VVARINNTFRRADQIQWANNIEPGQPGYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLAAVKKCGHMGGKVLVPTQEAVQKLISARLAADVLGVPTLLVARTDADAAD
LLTSDCDPYDSQFITGERTHEGFYRTNAGIEQAISRGLAYAPYADVVWCETSTPDLKLAQ
RFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDKTIASFQDQLAAMGYQYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVDKVQEPEFAAIDRGYTFASHQQEVGTGYFDKVTTIIQGGR
SSVTALTGSTEEQQFSPTSH
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaccgtactcagcaaattcagcagcttgaagaaacgtggagccaaccacgc
tggaaaaatatcacccgaccttacacggcggcagaagtgatcagcctgcggggttcagtc
aatccggagtgtacgctggctcagcacggagctgcccgcctgtggaatttactccacggc
gcatcgcgtaaagggtatgtgaattgcctcggcgcgctgacaggtggccaggccttacaa
caggcaaaagcgggtatcgaagccatttatctctcgggatggcaagttgccgcggatgcc
aatacggcttccagtatgtatcccgaccagtctttgtatcctgtgaattcggtgcctgaa
gttgtggcgcggattaacaacacttttcgtcgcgctgatcagatccagtgggccaataac
attgagcccgggcagcctggctataccgactatttcctgccgattgtggcggacgctgaa
gccggttttggtggcgtactcaatgcctttgaactgatgaaatccatgattgaagccggt
gctgccgccgttcattttgaagatcagcttgctgcggtgaagaagtgcgggcatatgggc
ggcaaagttctggtgccgacacaggaagccgtacagaagctgatttccgcgcgtcttgcc
gccgatgttcttggtgtgccgacgttgttggtggcacgtaccgatgccgatgcggcagat
ttactgacgtcggactgcgacccgtatgacagccagtttattaccggcgaaagaacacat
gaaggtttctaccggacgaacgccggtattgagcaggccatcagtcgcggtctggcgtac
gcaccttatgccgacgtagtgtggtgcgagacatcgacgcctgatctgaaactggctcag
cgttttgctgaggccatccacgctaaattcccgggcaaattgctggcctataactgttcg
ccatcgtttaactggaagaagaatctcgacgataaaaccatcgccagtttccaggaccag
ttggccgcgatgggttaccagtatcagttcattacgctggcgggcattcacagcatgtgg
ttcaacatgttcgatcttgcccatgcttatgcacagggcgaggggatgaagcactacgtg
gataaagtgcaggagccggaatttgcagccatagatcgcggctatacctttgcttctcat
cagcaggaagtcggaaccggctatttcgataaagtcactaccattattcagggcggtcgc
tcctcggttaccgcactcaccggctctaccgaagaacagcagttttctccgacgtcacac
tga

DBGET integrated database retrieval system