KEGG   Rahnella sp. Y9602: Rahaq_4115Help
Entry
Rahaq_4115        CDS       T01422                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00620  Pyruvate metabolism
rah00630  Glyoxylate and dicarboxylate metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01120  Microbial metabolism in diverse environments
rah01200  Carbon metabolism
Module
rah_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rahaq_4115
   00630 Glyoxylate and dicarboxylate metabolism
    Rahaq_4115
Enzymes [BR:rah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rahaq_4115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADW75703
JGI: Rahaq_4115
UniProt: A0A0H3FF97
Position
complement(4480282..4481880)
Genome map
AA seq 532 aa AA seqDB search
MSEQITRSQLGFTRRFGENEAQILTEEAVDFLSELVVRFTPLRNRLLADRIAVQQKIDQG
VLPDFISETHSIKNSDWKVRGIPADLLDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPDWQKVIEGQINLRDAVNGSISYTNESGKIYQLKPDPAVLICRVRGLHLPEKHVNWQG
EAIPGSLFDFALYFFHNYRALLAKGSGPYFYLPKMQSYHEADWWSQVFSFAEDYAGLARG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHSDRILPDRQSV
TMTQPFLNAYSRLLIKTCHRRGAFAMGGMAAFIPSKDVKRNEWVLNKVRTDKELEANNGH
DGTWIAHPGLADTVLEVFDKALGNRSNQLDVLREEDAEITAEQLLEPCSGERTEEGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHGKTLNDGQPVTKPLFRR
MLNEEMLVIQQELGEQRFSAGRFTQAAALMEKITTQDELIDFLTLPGYQLLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaaattacccgcagtcagcttggttttacgcgccgttttggtgaaaacgaa
gcgcaaattctgaccgaagaagccgtggattttttatccgaactggttgtccgttttacc
ccgctgcgaaatcgattactggccgatcgcattgccgtacagcagaagatagatcagggg
gtgttgcctgattttatttcggaaacgcattccataaaaaattcagattggaaggtacgg
ggcattccggctgatttactggatcgccgggtagaaatcactggtcctgtcgaacgcaag
atggtgatcaatgcgctgaacgccaatgtaaaagtctttatggcggattttgaggactct
ctggcaccggactggcagaaagttatagaagggcagattaacttacgcgatgcggtgaac
gggagtatcagctacaccaatgaatccgggaaaatttatcagctcaaacctgatcctgcc
gttctgatttgtcgtgtacgtggcctgcatttacctgaaaagcatgtgaactggcagggt
gaagctattcccggttcgttgttcgacttcgctttgtactttttccataactatcgcgca
ttactggcaaaaggcagtggcccctatttctatctgccaaaaatgcagtcttatcatgag
gctgactggtggagccaggtcttcagttttgccgaggattatgcgggattggcgcggggc
acgattaaagccacggtgctgattgaaaccctgcctgcggttttccagatggacgaaatc
ctttaccacttgcgcgatcacattgtcggactgaactgtggtcgctgggattacatcttc
agttatatcaaaacgttgaagaatcattctgaccgtatattacctgaccgtcagtccgta
acgatgactcagccttttctaaatgcttattcccggctgctgattaaaacctgtcaccgg
cgtggggcatttgcgatgggcggaatggcagcatttattcccagcaaagacgttaagcgt
aacgagtgggtgctgaataaagtccgcacagacaaagagctggaagcgaataacggacat
gatggtacctggattgcacaccctgggctggcagacaccgtgcttgaagtgttcgacaaa
gcgctgggtaaccgttcaaaccagctggatgtactacgtgaagaagatgccgaaattact
gcagagcaattactcgaaccttgttccggcgagcgtactgaagagggaatgcgcgccaat
attcgcgtcgcagtgcaatacattgaagcctggatttctggcaacggctgcgtcccgatt
tacgggttgatggaagatgctgccacggctgaaatctcccgcacatccatctggcaatgg
atccaccacggcaaaacgcttaatgacggacaacccgtcaccaagccgttattccgccgc
atgctgaacgaagaaatgctggttattcagcaggagttgggcgaacaacgtttcagtgcc
ggtcgtttcacgcaggcggctgccttgatggaaaaaatcaccacacaagatgagttaatc
gacttcctgaccctgccgggctatcagctgctggcctga

DBGET integrated database retrieval system