KEGG   Rahnella sp. Y9602: Rahaq_4149Help
Entry
Rahaq_4149        CDS       T01422                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00071  Fatty acid degradation
rah00280  Valine, leucine and isoleucine degradation
rah00281  Geraniol degradation
rah00310  Lysine degradation
rah00362  Benzoate degradation
rah00380  Tryptophan metabolism
rah00410  beta-Alanine metabolism
rah00640  Propanoate metabolism
rah00650  Butanoate metabolism
rah00903  Limonene and pinene degradation
rah00930  Caprolactam degradation
rah01040  Biosynthesis of unsaturated fatty acids
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
rah01120  Microbial metabolism in diverse environments
rah01130  Biosynthesis of antibiotics
rah01200  Carbon metabolism
rah01212  Fatty acid metabolism
Module
rah_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rahaq_4149
   00650 Butanoate metabolism
    Rahaq_4149
  Lipid metabolism
   00071 Fatty acid degradation
    Rahaq_4149
   01040 Biosynthesis of unsaturated fatty acids
    Rahaq_4149
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rahaq_4149
   00310 Lysine degradation
    Rahaq_4149
   00380 Tryptophan metabolism
    Rahaq_4149
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rahaq_4149
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rahaq_4149
   00281 Geraniol degradation
    Rahaq_4149
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rahaq_4149
   00930 Caprolactam degradation
    Rahaq_4149
Enzymes [BR:rah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rahaq_4149
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rahaq_4149
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rahaq_4149
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Rahaq_4149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADW75737
JGI: Rahaq_4149
UniProt: A0A0H3FL59
Position
4531769..4533961
Genome map
AA seq 730 aa AA seqDB search
MLYQGETLHLHWLDGGIAELVFDAPGSVNKLDTQTVASLGEAIAVLEKQSDLKGLLLSSA
KPAFIVGADITEFLSLFNAPAEKLHEWLDFANSIFNRLEDLPVPTLSAISGYALGGGCEC
VLATDFRISTADARIGLPETSLGIMPGFGGSVRLPRLIGTDSALEIIAAGKNISGKEALK
VGLVDAVVEADKLRDAGISMLRNAVDGKLEWHNRRDPKRLPLKLSQIEAAMSFSVAKSMV
MQNAGKHYPAPMSAVKTIEAAARLGRDEALQLETASFVPLAQSKEARALVSIFLNDQFVK
SKAKKLAQDSEKPKQAAVLGAGIMGGGIAYQSALKGVPVVMKDINDQSLTLGMNEAAKLL
NKQLERGKLDGLKMAKVLSTIHPTLDYSGIERASVVVEAVVENPKVKAAVLAEAESLLGT
DTVLASNTSTIPIDLLASSLKRPENFCGMHFFNPVHRMPLVEIVRGEKTSDKTISRIVSY
ALAMGKTPIVVNDCPGFFVNRVLFPYFSGFSLLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMARDYRDAVDVLFDNRRFGQKNQLGFYRYSEDSKGKP
RKEVDEQAISLLADNLKPAHTDFSPQDIIARMMIPMINEVVRCFEEGIIASPAEADMALV
YGIGFPPFHGGPFRYLDTLGTTEYLKMTEQYAHLGPMYQAPEGLRAKAQTNESYYPVAAP
LENFSTGNQA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgaaacactacacctgcactggctcgacggcggtatcgcggagctg
gtgtttgatgccccaggctcggttaacaagctcgacacccaaactgtcgccagcctgggc
gaagccattgcagtacttgaaaaacagtctgacctgaaaggtctgctgctcagttcggcc
aaaccagcgtttatcgtgggcgcggatatcaccgaatttttatccctgttcaacgcgcca
gccgaaaaactgcatgaatggctggatttcgccaacagcatttttaaccggctggaagac
ctgccggtaccgacactttctgccatcagcggttatgcgctgggcggcggttgcgaatgc
gtgctggcgacagattttcgtatcagcactgccgatgcccggattggcctgccggaaacc
agtttagggattatgccgggcttcggcggttccgtacgtctgccacgtctgattgggacc
gatagtgcgctggaaattatcgccgccggtaaaaatatcagcggaaaagaggccctgaaa
gtcgggctggtcgatgcagtggttgaagccgataaactgcgcgacgctggcatcagcatg
ctgagaaacgccgttgacggcaaactggaatggcataaccgtcgtgatcctaaacgtctg
ccgttgaaactgagccagattgaagcggcgatgagcttcagcgtcgccaaaagtatggtc
atgcaaaatgccggtaaacactatccggcgcccatgagcgcggtgaaaaccatagaagcc
gcggcccgtctgggtcgtgatgaagcgttgcagctggaaaccgccagctttgtgccgctc
gcacaatcaaaagaagcccgcgcactggtcagtattttccttaacgatcagtttgtgaaa
agcaaagccaaaaaactggcgcaagacagcgaaaaaccaaaacaggccgccgtattgggc
gcgggcattatgggcggcgggatcgcctaccagtctgcgctgaaaggcgtgccggttgtg
atgaaagatatcaacgaccagtccctgacgctcggcatgaacgaggctgccaagttgctg
aacaagcaactggagcgcggtaaactcgacggtctgaaaatggctaaagtgctgtcgacc
attcatccgacgctggattacagcggcatcgaacgtgcctctgtggtcgttgaagccgtg
gtcgagaatcctaaagtgaaggccgcggtgctggcggaagcggaatctctgctcggcacc
gataccgttctggcctcgaatacctcgaccattcctatcgatctgttggcgtcttcgctc
aaacgcccggaaaacttctgtggtatgcacttcttcaacccggtgcatcgtatgccgctg
gtcgaaatcgtgcgtggtgagaaaacctcagacaaaacgatttcgcgcatcgtttcttac
gcactggcgatgggtaaaacgcctatcgtggtcaacgactgcccgggattcttcgtcaac
cgcgtactgttcccgtatttctccggtttcagtctgttactgcgtgatggcgctgatttc
cgccagatcgacaaagtgatggaaaaacagttcggctggccgatgggtccggcttatctg
ctggatgtggtcggcatcgacaccgcgcatcacgcccaggccgtgatggccgccggtttc
cctgagcgcatggcacgggattaccgtgacgctgttgatgtgctgtttgataaccgtcgt
tttgggcagaaaaatcaactcggtttctaccgttacagcgaagacagcaaaggcaagccg
cgcaaggaagttgacgaacaggcgatcagtctgctggccgacaacctgaaaccagcacac
actgacttctcaccgcaggacatcatcgcccgcatgatgattccgatgattaacgaagtg
gtgcgctgctttgaggaaggcattattgccagcccggccgaagccgacatggcgctggtt
tacggcatcggattcccccctttccacggcggcccgttccgttatctcgataccctcggt
accactgagtatctgaaaatgactgaacagtatgcacatctggggccgatgtatcaggca
ccggaagggctacgcgccaaagcgcaaaccaatgaaagttactatccggttgccgctccg
ctggaaaacttcagcaccggtaatcaggcataa

DBGET integrated database retrieval system