KEGG   Rahnella sp. Y9602: Rahaq_4230Help
Entry
Rahaq_4230        CDS       T01422                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rahaq_4230
Enzymes [BR:rah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rahaq_4230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4621033..4622025)
Genome map
AA seq 330 aa AA seqDB search
MPVNFGKWLTREKEFSAFATGPLLDFWRTREEGEFSGVDDVPIRYVRFCSPAHDKVIVVS
PGRIESYVKYPEVAYDLFHCGYDVMIVDHRGQGRSGRMLDDPHCGHVKHFDDYVEDFESF
YQLEIAPRQYAKKFALAHSMGGAILALFLAKNPDKFDAAALLAPMTGIYLPMPGWISRRI
LNWAENRPLRRDGYALGTGHWRPLPFVVNRLTHSRERYRRNLRFYADYPELQVGGPTYHW
VREGIEAGMHILKEAEKITTPVLLLQASEDRVVDNRSHLAFCQAMAVAGHPCEGEKPLVI
EGARHEILFERDDLRAQALDAIMRFFARQH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgaattttgggaagtggttaacacgagagaaggagttttccgccttcgcgacc
ggacctttgctggatttctggcgtacgcgcgaagaaggcgagtttagcggcgttgacgat
gtcccgatccgctatgtccggttctgttcccccgcgcatgataaagtcatcgtggtgtca
ccgggtcgtatagaaagctacgtaaaatatcctgaagtagcctacgatttattccattgc
ggctacgatgtcatgattgtcgatcaccgtggtcaggggcgttccgggcgtatgctcgac
gatccgcattgtggccacgttaagcattttgacgattatgttgaggatttcgaaagcttt
tatcagctggagattgccccacgtcagtacgcgaaaaagttcgcgctggcacactccatg
ggcggtgcgatcctggcgctgtttctggcgaaaaatccggacaagtttgatgcagcggcg
ttactcgcgccgatgaccggcatttatttgccgatgccgggctggatttcccgccggatc
ctcaactgggcggagaatcgtccgctacgccgtgacggctatgcgctgggcaccggtcac
tggcggccattaccgtttgtggtcaaccgcctgacacacagccgtgagcgttatcgccgt
aatctgcgtttttatgccgattaccctgagctgcaggtcggtgggccaacctatcattgg
gtacgtgaagggattgaggcggggatgcatatcctgaaagaagccgaaaaaatcaccacc
cctgttctgttattgcaggcgagcgaagaccgtgtggtggataaccggtcccatcttgct
ttttgtcaggccatggccgttgcgggacacccttgtgaaggggaaaaaccgctggtcatt
gaaggcgcgcgccatgagatcctgtttgaacgggacgacctgagggcacaggcgctggac
gctatcatgcgcttttttgcgcgacagcattaa

DBGET integrated database retrieval system