KEGG   Rahnella sp. Y9602: Rahaq_4234Help
Entry
Rahaq_4234        CDS       T01422                                 

Definition
(GenBank) Phospholipase A(1)
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00564  Glycerophospholipid metabolism
rah00565  Ether lipid metabolism
rah00590  Arachidonic acid metabolism
rah00592  alpha-Linolenic acid metabolism
rah01100  Metabolic pathways
rah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rahaq_4234
   00565 Ether lipid metabolism
    Rahaq_4234
   00590 Arachidonic acid metabolism
    Rahaq_4234
   00591 Linoleic acid metabolism
    Rahaq_4234
   00592 alpha-Linolenic acid metabolism
    Rahaq_4234
Enzymes [BR:rah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Rahaq_4234
    3.1.1.32  phospholipase A1
     Rahaq_4234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ADW75820
JGI: Rahaq_4234
UniProt: A0A0H3FG29
Position
complement(4625449..4626327)
Genome map
AA seq 292 aa AA seqDB search
MRKNWAVGAAMLAMPMLGHAAEATVQEVHDKPAVRGSIIANMLQEHDNPFTLYPYEQNYL
IYTDTSNINKKAIQSYDWADKARHDEVEFQLSLAFPLWRGIAGDNSVLGASYTQKSFWQL
SNSGESSPFRETNYEPQLFLAWATDYDFLGWTLREAEYGVSHQSNGRSDPTSRSWNRVYA
RFMAQNGNWQVDLKPWYRIPESDENDDNPDINKYMGYYRLKVGYAWGDSVFSVESRYNWN
TGYGGATTGWSYPISKQVRFYTQVFSGYGESLIDYNHKQTRIGVGIMLNDIM
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaattgggctgtcggagccgccatgctggcgatgccaatgctgggacacgcc
gcagaggccactgtgcaggaagtgcatgataaacctgcggtacgcggaagtattattgcg
aatatgttgcaggagcacgacaacccgttcacattatatccttacgaacaaaactacctg
atttacactgataccagcaatatcaacaagaaagccattcagtcttacgactgggcagat
aaagcacgtcatgatgaagtcgagttccagctcagcctggcgttcccgttgtggcgtgga
attgcgggtgataattcggtgctcggcgcgtcttacacgcaaaaatcattctggcagctt
tccaacagcggcgagtcttcaccttttcgtgagaccaactacgagccacagcttttcctc
gcctgggcaacggattacgatttcctcggctggacattgcgcgaagcagaatatggtgtc
agccatcagtctaacggccgctcagatccgacgtcccgcagctggaaccgcgtgtatgcc
cgtttcatggcgcaaaacggtaactggcaggtggatttaaaaccgtggtaccgcatccct
gaaagcgatgaaaacgacgataacccggacatcaacaaatacatgggttattaccgcctg
aaagtcggttatgcgtggggtgacagcgtgttcagcgtggaaagccgttacaactggaat
accggttacggcggtgcgacgactggctggagctacccgatttccaaacaggttcgcttc
tatactcaggtatttagcggctacggcgagtcattgatcgactacaaccataagcagacc
cgtatcggtgtgggtattatgcttaacgacatcatgtaa

DBGET integrated database retrieval system