KEGG   Rahnella sp. Y9602: Rahaq_4249Help
Entry
Rahaq_4249        CDS       T01422                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rah  Rahnella sp. Y9602
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rahaq_4249
Enzymes [BR:rah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rahaq_4249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4640746..4641495
Genome map
AA seq 249 aa AA seqDB search
MTILVTRPSPAGEALVSRLRALGRVAFHSPLIDFAPGNQLASLPNLLSSLNQQDLVFVLS
QHAVSYADRALRQSTTNWPDTVNYFAIGRTTGLIFHRVSSLPVLYPQDGETSETLLNLPA
LQRIQGKKALILRGNGGRELLAETLTERGVDVTYCECYQRSPVYYDASEQSALWQRAGVD
TLVVTSGEMLQQLYQLVPDYYRNSWLLRCNLVVVSERLAALARQLGWSAIRVAENADNDA
LIRALQLPD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccattctggtcacccgcccctctccggcaggagaagcactggttagccggctgcgc
gctctggggcgggttgccttccattccccgctgattgattttgcaccggggaaccagctc
gcatcgcttccgaacctgctatcctcattaaatcagcaagatctggtgttcgtgctctcg
caacatgccgtcagttacgctgaccgggctttgcgccagtccaccacaaactggccggac
accgtgaattattttgccattggtcgcaccactggcctgattttccaccgggtcagcagc
ctgccggttctctatcctcaggatggcgaaaccagcgagacgctattgaatcttccggca
ttgcaacgcatacagggtaaaaaagcgctgatattgcgcggtaatggcggacgggagctg
ttagccgaaacgctgacagaacgcggtgtcgatgtcacttactgcgaatgttatcagcgc
agcccggtttactacgatgccagtgaacagagtgcactctggcaacgggccggagttgat
acgctggtcgtgaccagcggagaaatgctgcaacagttgtaccagttagttcctgattac
tatcgaaattcatggttactgcgctgtaatctggtggtggtcagtgaacgtttggcagcc
cttgcacgccagcttggctggagcgcaattcgggttgctgagaatgcagacaatgatgcg
ctgatccgcgcattacaactacctgactaa

DBGET integrated database retrieval system