KEGG   Rahnella sp. Y9602: Rahaq_4316Help
Entry
Rahaq_4316        CDS       T01422                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rahaq_4316
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rahaq_4316
Exosome [BR:rah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rahaq_4316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4726770..4728293
Genome map
AA seq 507 aa AA seqDB search
MSADTTHEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKSGWVEHDPMEIWS
SQSSVLVEVLAKADINSDQIAGIGITNQRETTIVWEKETGKPIYNAIVWQCRRTADICEK
LKKDGLEEYIRHNTGLVIDPYFSGTKLKWILDNVEGSRERAKRGELLFGTVDTWLVWKMT
QGRVHVTDYTNASRTMLFNIHDLQWDERMLEVLDIPREMLPEVRSSSEIYGQTNIGGKGG
TRIPIAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGTEAVASKNGLLTTIACGP
RGEVNYALEGAVFVGGASIQWLRDELKLISDATDSEYFAMKVKDTNGVYVVPAFTGLGAP
YWDPYARGAIFGLSRGANSNHIIRATLESIAYQTRDVLDAMQADSGARLQALRVDGGAVA
NNFLMQFQSDILGTRVERPEVLEVTALGSAFLAGLAVGFWNDLEEVRSKATIEREFRPSI
ETTERNVRYKGWQKAVARVRSWEDHDE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagatacgactcacgaaaaaaaatacattgttgcactcgaccagggtacaacc
agttcacgcgcggtagtgctggatcacgatgccaatatcgtcagcgtgtcacaacgcgaa
ttcacccagatctaccctaagtcaggctgggttgagcacgacccgatggaaatctggtca
tcgcaaagctcggtgctggtggaagtgctggcgaaagccgacattaactccgatcagatt
gccggtatcggtatcaccaaccagcgcgaaaccaccatcgtgtgggaaaaagaaactggc
aagccaatctataacgcgattgtctggcaatgtcgccgaactgctgacatctgcgaaaaa
ctgaaaaaagacggtctggaagaatacattcgccataacaccggcctggttatcgaccct
tacttctccggcaccaaactgaagtggatcctcgacaacgttgaaggctctcgcgaacgc
gctaaacgcggcgaactgctgttcggcaccgtcgacacctggttggtctggaaaatgacg
cagggacgtgttcacgtgacggattacaccaacgcttcgcgtaccatgctgttcaacatc
catgatctgcaatgggatgagcgcatgctggaagtgctggatattccacgtgaaatgctg
ccggaagttcgctcttcttctgagatttacggccagaccaacattggtggtaaaggcggt
acgcgtattcctatcgctggcatcgcaggtgaccagcaggcggcgctctatggtcagctg
tgtgtacaaccgggtatggcgaaaaacacctacggcactggctgcttcctgctgatgaat
accggtactgaagcggtcgcctctaaaaatggcctgctgactaccatcgcctgcggcccg
cgcggcgaagtcaactacgcgctggaaggggctgtgtttgtcggcggtgcgtccattcag
tggctgcgtgatgaactgaagctgatcagcgacgcaactgactccgaatatttcgccatg
aaagtgaaagacacgaacggcgtttacgtagtgcctgcctttaccggcctcggcgcccct
tactgggatccgtatgcccgcggcgcaatcttcggtctgagccgtggtgcgaacagcaac
cacatcatccgcgcgacgctggaatctatcgcttaccagacccgcgacgtactggatgcc
atgcaggcagactcgggcgctcgtctgcaggcactgcgtgtggacggcggtgcggtggcc
aacaacttcctgatgcaattccagtcagacattcttggcacccgcgttgagcgccctgaa
gtgctggaagtcaccgcgctgggttctgctttcctggcaggtctggccgtcggcttctgg
aacgacctggaagaagtgcgcagcaaagcgaccatcgaacgtgaattccgcccaagcatt
gaaacgacggaacgtaatgtccgctataaaggctggcaaaaagcggtggcacgcgttcgt
tcgtgggaagatcacgacgagtaa

DBGET integrated database retrieval system