KEGG   Rahnella sp. Y9602: Rahaq_4322Help
Entry
Rahaq_4322        CDS       T01422                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq_4322
   01230 Biosynthesis of amino acids
    Rahaq_4322
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_4322
   00051 Fructose and mannose metabolism
    Rahaq_4322
   00562 Inositol phosphate metabolism
    Rahaq_4322
Enzymes [BR:rah01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rahaq_4322
Exosome [BR:rah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rahaq_4322
  Exosomal proteins of bladder cancer cells
   Rahaq_4322
  Exosomal proteins of melanoma cells
   Rahaq_4322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4733101..4733868
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAALRTELSTVVGCGVAIAPPEVYLSQAKHALAGSRIA
LGAQNVDANLSGAFTGEISADMLKDIGAQYIIIGHSERRTYHKESDELIAKKFGVLKEAG
LTPVLCIGETEAENEAGKTEAVCAKQLDAVLSTLGAKAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagtgatgggtaactggaagcttaacggcagcacccacatggttaac
gaactgattgctgctctgcgtactgaactgagcacagttgtaggttgtggcgttgcaatt
gctccaccagaagtttacctgtcacaggctaaacacgctctggctggcagccgtattgcg
ctgggtgctcagaacgttgatgctaacctgtctggcgcattcaccggtgaaatctctgcc
gacatgctgaaagacatcggtgcgcaatacatcatcatcggtcactcagaacgccgcact
taccacaaagaaagcgacgagttgatcgcgaaaaaattcggcgtgttgaaagaagcgggc
ctgactcctgttctgtgcatcggtgaaaccgaagcagaaaacgaagcaggcaaaactgaa
gccgtttgcgctaaacaactggacgcggttctgagcactctgggtgcgaaagcattcgaa
ggcgcagtcatcgcttacgaacctgtttgggcgatcggtaccggcaaatctgccaccccg
gctcaggctcaggctgttcacaaattcatccgtgaccacattgcgaaacaagatgctgcg
gttgctgaacaagttatcatccagtacggcggttctgttaacgctgcaaatgctgctgaa
ctgttcacccagccagacatcgatggcgcactggttggcggcgcatcactgaaagcagac
gctttcgctgtgatcgtgaaagccgctgctgaagctaaacaagcgtaa

DBGET integrated database retrieval system