KEGG   Rahnella sp. Y9602: Rahaq_4324Help
Entry
Rahaq_4324        CDS       T01422                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq_4324
   01230 Biosynthesis of amino acids
    Rahaq_4324
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_4324
   00030 Pentose phosphate pathway
    Rahaq_4324
   00051 Fructose and mannose metabolism
    Rahaq_4324
   00052 Galactose metabolism
    Rahaq_4324
  Energy metabolism
   00680 Methane metabolism
    Rahaq_4324
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rahaq_4324
Protein phosphatases and associated proteins [BR:rah01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rahaq_4324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4735110..4736096)
Genome map
AA seq 328 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALSADLEVYGIEDGYLGMYENRMRKLDRYSVSD
MINRGGTFLGSARFPEFRDPEMRKVALQNMKDRGIDGLVVIGGDGSYAGADLLTKEGGIR
CIGLPGTIDNDVAGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDDIEELAKYIEKET
CRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLEEDRDYSQGGFCVGVENEKMVH
ELISICIAPENKKSKFKEDWYDTAKKLF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaaattggtgtactgacaagtggtggcgatgccccaggcatgaatgctgcg
atccgtggcgttgtccgcgccgctttatctgcagatttggaagtctacggtattgaagat
ggctacctcggcatgtatgaaaaccgcatgcgcaaactggatcgctacagcgtctccgat
atgatcaaccgtggcggtactttcctgggttcagcacgtttcccggaattccgtgatcca
gaaatgcgtaaagttgcgctgcagaatatgaaagaccgtggtatcgatggccttgtggtt
atcggcggtgacggttcatatgccggtgcagacctgctgaccaaagaaggtggcatccgt
tgcatcggcctgccaggcacaatcgataacgacgttgcgggcactgactacactatcggt
ttcttcacggcgctgggtacagtggttgaagccattgaccgtttacgtgatacctcctct
tcacaccagcgtatctctattgttgaggtgatgggccgttattgcggtgatttgacctta
gcagcagcgattgccgggggttgcgaatttatcgctatccctgaagttgaattcaaacgt
gatgatctggttgctgaaatcaaagccggtatcgcgaaaggcaaaaaacatgccatcgtt
gccatcaccgagaagttagatgacattgaagaactggctaaatacatcgagaaagaaacc
tgtcgtgaaacgcgtggcacggtattaggtcatattcagcgtggcggcgcacctgtcgct
tatgaccgtattctggcttcccgcatgggtgcgtatgctgttgacctgttgctggaagaa
gatcgtgactattctcagggcggtttctgcgtgggtgttgaaaacgagaaaatggttcac
gaactcatctcgatttgtatcgcgccagagaacaagaaaagcaaatttaaagaagactgg
tacgacacggcgaaaaaacttttctga

DBGET integrated database retrieval system