KEGG   Rahnella sp. Y9602: Rahaq_4369Help
Entry
Rahaq_4369        CDS       T01422                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rah  Rahnella sp. Y9602
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rah00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4779890..4780513
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAIRPGEKDGEHYFFVDKE
AFREMIERDAFLEHAEVFGNYYGTSRETIEQVLASGVDVFLDIDWQGAQQIRKKMPQARS
IFVLPPSKDELDRRLRGRGQDSEAVIAKRMAQAVAEMTHFAEYDYLIVNDDFDLALSDLK
TIIRAERLRLSRQRLRHDGLITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggcacgctatatattgtctccgcccctagtggagcaggcaaatcaagtctg
attcaggctttacttaaaacacaaccgctctacgacacacaggtttctatttctcatacg
acccgagctatacgtccgggcgagaaagatggcgagcattacttctttgtcgacaaagaa
gcgtttcgcgagatgattgaacgtgatgcctttttagaacacgcagaagtttttggtaac
tattacgggacttcgcgtgaaaccattgagcaggttttagcgtcgggtgtggatgttttt
ctggatatcgactggcaaggcgcgcagcaaattcggaaaaaaatgccgcaggcacgcagt
atttttgtcttaccgccatcgaaagatgagctagaccgtcgcctgcgtggccgcgggcaa
gacagcgaagccgttatcgcaaaacgtatggcacaagccgtagctgaaatgacacacttt
gccgaatacgactatttaattgtgaatgatgattttgatctggctttatcggatttaaaa
accattattcgcgctgaacgtctgcgtctgagccgtcagcggctccgtcatgacggatta
atcaccaaactattggcagactga

DBGET integrated database retrieval system