KEGG   Rahnella sp. Y9602: Rahaq_4369Help
Entry
Rahaq_4369        CDS       T01422                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rah  Rahnella sp. Y9602
Pathway
rah00230  Purine metabolism
rah01100  Metabolic pathways
Module
rah_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rahaq_4369
Enzymes [BR:rah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rahaq_4369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase MMR_HSR1 ABC_tran AAA_22 AAA_18 Adeno_IVa2 Viral_helicase1 CPT Dynamin_N AAA_29
Motif
Other DBs
NCBI-ProteinID: ADW75955
JGI: Rahaq_4369
UniProt: A0A0H3FGG7
Position
4779890..4780513
Genome map
AA seq 207 aa AA seqDB search
MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAIRPGEKDGEHYFFVDKE
AFREMIERDAFLEHAEVFGNYYGTSRETIEQVLASGVDVFLDIDWQGAQQIRKKMPQARS
IFVLPPSKDELDRRLRGRGQDSEAVIAKRMAQAVAEMTHFAEYDYLIVNDDFDLALSDLK
TIIRAERLRLSRQRLRHDGLITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaggcacgctatatattgtctccgcccctagtggagcaggcaaatcaagtctg
attcaggctttacttaaaacacaaccgctctacgacacacaggtttctatttctcatacg
acccgagctatacgtccgggcgagaaagatggcgagcattacttctttgtcgacaaagaa
gcgtttcgcgagatgattgaacgtgatgcctttttagaacacgcagaagtttttggtaac
tattacgggacttcgcgtgaaaccattgagcaggttttagcgtcgggtgtggatgttttt
ctggatatcgactggcaaggcgcgcagcaaattcggaaaaaaatgccgcaggcacgcagt
atttttgtcttaccgccatcgaaagatgagctagaccgtcgcctgcgtggccgcgggcaa
gacagcgaagccgttatcgcaaaacgtatggcacaagccgtagctgaaatgacacacttt
gccgaatacgactatttaattgtgaatgatgattttgatctggctttatcggatttaaaa
accattattcgcgctgaacgtctgcgtctgagccgtcagcggctccgtcatgacggatta
atcaccaaactattggcagactga

DBGET integrated database retrieval system