KEGG   Rahnella sp. Y9602: Rahaq_4478Help
Entry
Rahaq_4478        CDS       T01422                                 

Definition
deoxyribose-phosphate aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase
Orthology
K11645  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
rah  Rahnella sp. Y9602
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rahaq_4478
   01230 Biosynthesis of amino acids
    Rahaq_4478
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rahaq_4478
   00030 Pentose phosphate pathway
    Rahaq_4478
   00051 Fructose and mannose metabolism
    Rahaq_4478
  Energy metabolism
   00680 Methane metabolism
    Rahaq_4478
Enzymes [BR:rah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Rahaq_4478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRAHAQ01:45601..46650
Genome map
AA seq 349 aa AA seqDB search
MTDITKLLGKEADSLLQHQCSTITSDQLYLPGADFVDRVMIDNNRSPRVLAAMQNLYNTG
RLAGTGYLSILPVDQGVEHSAGASFAANPLYFDPKNIVELAIEAGCNCVASTYGVLASVS
RRYAHKIPFLVKLNHNETLSYPTQYDQTLYASVEQAFNLGAQAVGATIYFGSEESRRQIE
EISAAFERAHELGMVTVLWAYLRNPAFVKDGKDYHSSADLTGQANHLAATIGADIVKQKM
AENNGGYKAVKFGYTDERVYSKLTTDHPIDLVRYQLANCYMGRAGLINSGGAAGENDIQE
SVRTAVINKRAGGMGLILGRKAFKKSMKEGVGLINAVQDVYLDTKVTIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatcactaagttgttaggcaaagaagccgattcacttcttcagcatcaatgt
tccaccatcacctcagaccagctatacctgccgggcgccgattttgttgaccgtgtgatg
atcgacaataaccgttcgccgcgcgtactggctgcgatgcaaaacttgtataacaccgga
cggttagccggtaccggttatctgtcgattctgccggtcgatcagggtgttgaacactca
gcgggcgcctcgtttgccgcgaacccgttgtatttcgatcctaaaaatattgttgaactg
gcgatcgaggcaggctgtaactgcgtagcgtcaacttacggcgtgctggcttccgtttca
cgccgctacgcccataaaattccgttcctggtcaaactcaatcacaacgaaaccctgagt
tatccgacacaatatgaccagacactgtatgccagtgtggaacaggcgtttaatctcggt
gcgcaggctgtgggcgcgaccatttattttggctcagaagagtcacgtcgccagatagaa
gaaatttcagccgctttcgagcgggcgcatgaactgggcatggtgaccgtgttgtgggca
tatttgcgtaatccggcgtttgtgaaagacggcaaagattaccattccagcgccgactta
accggccaggcaaaccaccttgcagcgaccatcggcgcagacattgtgaaacagaaaatg
gcagaaaataatggtggctacaaagcggttaaattcggttataccgatgaacgcgtctat
tccaaactgacgaccgatcacccgattgatctggtgcgttatcagctggcgaactgttac
atggggcgggccggattgattaattccggcggtgccgcaggtgaaaatgatattcaggaa
tccgtgcgtacagcggtcatcaataaacgcgctggcgggatgggactgattctggggcgt
aaagccttcaagaaatcaatgaaagaaggcgtgggcttgattaatgccgttcaggatgtg
tacctggatacgaaagtgacgattgcctga

DBGET integrated database retrieval system