KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0410Help
Entry
RA0C_0410         CDS       T02107                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RA0C_0410
DNA repair and recombination proteins [BR:rai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RA0C_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
380239..380847
Genome map
AA seq 202 aa AA seqDB search
MNFPSKVLEKAVEEISGLPGIGRKSALRLALHLLRQPSSQGLALGDAIQNLVTEIKYCKE
CHNFSDTDICEICADDSRHAELLCVVEDVRDVMAIENTGKFKGKYLVLGGKISPMEGIGP
QQLNIETLESKLEIGEIEEVIFALSATMEGDTTVYYLYKKFKHFDIKFSNIARGISVGDE
LEYADEVSLGRSILNRIPYKGH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccaagtaaggttttagaaaaagcagtagaagaaatatcaggtctcccaggg
ataggcagaaagtcggctctcagactagcgcttcatttgcttagacaaccgagttcacaa
ggattagctctaggcgatgctatacaaaatctagttacagagataaaatattgtaaagaa
tgccataacttttcggacacagatatttgcgaaatttgtgcagatgacagtagacacgct
gaactcctatgcgttgtggaagatgtgagagatgtaatggcgatagaaaacacaggaaaa
ttcaaaggaaaatatttggttttaggaggaaaaatatcgcctatggaaggtattggacct
caacaattaaatatagaaactttagaaagcaaactagaaataggggagatagaggaggtt
atttttgcactatctgccactatggagggcgataccaccgtgtattatttgtataaaaag
tttaagcattttgacattaaattctccaatattgcgagagggatttccgtaggagatgaa
ctagagtacgccgatgaagtttctttggggaggtctattttgaaccgaataccttataaa
ggtcattaa

DBGET integrated database retrieval system