KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0441Help
Entry
RA0C_0441         CDS       T02107                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RA0C_0441
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RA0C_0441
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RA0C_0441
Enzymes [BR:rai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RA0C_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(418054..419238)
Genome map
AA seq 394 aa AA seqDB search
MNYQNPDKEGYYGEFGGAFIAEMLYPNVKELQDKYLEIIYSEDFQKEFKDLLKNYVGRET
PLYFAPNLSRQYGTKIYLKREDLNHTGAHKINNALGQALLAKKLGKQRIIAETGAGQHGV
ATATACALLGLECIVYMGEVDIDRQAPNVARMKMLGAKVVPATSGSKTLKDAVNEALRDW
INNPTTTHYIIGSVVGPHPFPDLVARFQSVISEEIKVQLQEQEGRDYPDHLIACVGGGSN
AAGTFYHFVNNEKVNIIAAEAGGLGVHSGETAATTALGSIGVLHGSQSLVIQTKDGQVIE
PYSISAGLDYPGIGPMHANLYQQKRAEFLSINDDEALKSAFNLTKTEGIIPALESAHALA
VLDKKKFGKEDIVVICLSGRGDKDMETYLKYLNI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaaaatccagataaagaagggtattacggagaatttggcggtgcttttatc
gccgaaatgctctaccctaatgttaaagaattacaagacaaatacttggaaatcatttat
tcggaagattttcaaaaggagtttaaagatttattaaaaaactatgtaggaagggaaaca
ccattgtattttgcacctaatttgagccgacaatatggtactaaaatctatcttaagaga
gaagatttaaaccatacgggagcccacaaaatcaataatgctttggggcaagcactctta
gcaaaaaagttgggtaaacagcgtatcatagccgaaacaggtgctggacaacacggcgtt
gccactgctacggcgtgtgccttgctcggtttagagtgtattgtttatatgggcgaagta
gatattgaccgacaagctcctaatgttgccagaatgaaaatgttaggtgctaaagtcgtt
cctgcgacttcgggttccaaaactttaaaagacgctgtaaatgaggctctgagagattgg
ataaataatcctacaaccacccattatattataggtagcgtggtaggccctcaccctttc
cctgatttggtggcaagatttcagtctgttatttcagaggaaattaaagtccagttacaa
gaacaggaaggcagagattatcccgaccacctcattgcgtgtgtgggcggcggtagtaac
gccgcagggactttttatcatttcgtgaataatgagaaagtcaatattattgcggcagaa
gctggtggtttgggcgttcattctggagaaactgctgcaacaacggctttgggaagtatt
ggagttttgcacggcagtcagagtttggttattcagaccaaagacggacaagtgattgag
ccctactctatttctgcggggttggactatccagggattggaccgatgcacgccaatctt
taccaacaaaaacgagccgaatttttaagtatcaacgatgatgaagctctaaaatccgca
tttaatttgactaaaacagaaggtattattccagcgttagaaagtgcccacgccttggcg
gttttggataaaaagaagtttggaaaagaagacattgttgtcatctgcctaagcggtaga
ggtgataaggatatggaaacttatttaaaatatctaaatatttaa

DBGET integrated database retrieval system