KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0441Help
Entry
RA0C_0441         CDS       T02107                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
rai00260  Glycine, serine and threonine metabolism
rai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rai01100  Metabolic pathways
rai01110  Biosynthesis of secondary metabolites
rai01130  Biosynthesis of antibiotics
rai01230  Biosynthesis of amino acids
Module
rai_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RA0C_0441
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RA0C_0441
Enzymes [BR:rai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RA0C_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFD55421
UniProt: E4T8Z3
Position
complement(418054..419238)
Genome map
AA seq 394 aa AA seqDB search
MNYQNPDKEGYYGEFGGAFIAEMLYPNVKELQDKYLEIIYSEDFQKEFKDLLKNYVGRET
PLYFAPNLSRQYGTKIYLKREDLNHTGAHKINNALGQALLAKKLGKQRIIAETGAGQHGV
ATATACALLGLECIVYMGEVDIDRQAPNVARMKMLGAKVVPATSGSKTLKDAVNEALRDW
INNPTTTHYIIGSVVGPHPFPDLVARFQSVISEEIKVQLQEQEGRDYPDHLIACVGGGSN
AAGTFYHFVNNEKVNIIAAEAGGLGVHSGETAATTALGSIGVLHGSQSLVIQTKDGQVIE
PYSISAGLDYPGIGPMHANLYQQKRAEFLSINDDEALKSAFNLTKTEGIIPALESAHALA
VLDKKKFGKEDIVVICLSGRGDKDMETYLKYLNI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaaaatccagataaagaagggtattacggagaatttggcggtgcttttatc
gccgaaatgctctaccctaatgttaaagaattacaagacaaatacttggaaatcatttat
tcggaagattttcaaaaggagtttaaagatttattaaaaaactatgtaggaagggaaaca
ccattgtattttgcacctaatttgagccgacaatatggtactaaaatctatcttaagaga
gaagatttaaaccatacgggagcccacaaaatcaataatgctttggggcaagcactctta
gcaaaaaagttgggtaaacagcgtatcatagccgaaacaggtgctggacaacacggcgtt
gccactgctacggcgtgtgccttgctcggtttagagtgtattgtttatatgggcgaagta
gatattgaccgacaagctcctaatgttgccagaatgaaaatgttaggtgctaaagtcgtt
cctgcgacttcgggttccaaaactttaaaagacgctgtaaatgaggctctgagagattgg
ataaataatcctacaaccacccattatattataggtagcgtggtaggccctcaccctttc
cctgatttggtggcaagatttcagtctgttatttcagaggaaattaaagtccagttacaa
gaacaggaaggcagagattatcccgaccacctcattgcgtgtgtgggcggcggtagtaac
gccgcagggactttttatcatttcgtgaataatgagaaagtcaatattattgcggcagaa
gctggtggtttgggcgttcattctggagaaactgctgcaacaacggctttgggaagtatt
ggagttttgcacggcagtcagagtttggttattcagaccaaagacggacaagtgattgag
ccctactctatttctgcggggttggactatccagggattggaccgatgcacgccaatctt
taccaacaaaaacgagccgaatttttaagtatcaacgatgatgaagctctaaaatccgca
tttaatttgactaaaacagaaggtattattccagcgttagaaagtgcccacgccttggcg
gttttggataaaaagaagtttggaaaagaagacattgttgtcatctgcctaagcggtaga
ggtgataaggatatggaaacttatttaaaatatctaaatatttaa

DBGET integrated database retrieval system