KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0443Help
Entry
RA0C_0443         CDS       T02107                                 

Definition
indolegene-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RA0C_0443
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RA0C_0443
Enzymes [BR:rai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RA0C_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(419893..420669)
Genome map
AA seq 258 aa AA seqDB search
MTILDKIVDCKLDEIQQAKKQTPLEKLKDTPFFYQPTRGFIESLKSNPYGIIAEFKRKSP
SKNNINIEAKIQAILPLYKAYGAACVSVLTDTPFFGGSLTDLEEANAYDIPLLRKDFIVD
DYQIYQAKAHGADCILLIANILSKSQIEDLTDTAHHLGLDVLLEFYSGEDFDKYYSKLKM
VGINNRNLNTFEVDYEHAIRMRNQLPEDTLSVAESAIYSPEIYKKLKNNGFEAFLMGEYF
MKQDHVGAALQSFIEEIK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccattttagacaaaatagtagattgtaagctggacgaaattcagcaagccaaaaag
cagacgccgttagaaaaactcaaggacactccgtttttctatcagcctacacgaggtttt
attgagagtttaaaatccaatccgtatggaattatagccgagtttaaaaggaaatcgccc
tctaaaaacaacatcaacatagaggctaaaatccaagcgattttaccgctatataaggca
tacggagcggcttgtgtgtctgtattgacggatacgcctttcttcgggggaagtttaacc
gatttggaagaagccaatgcttacgatatacctttgctaaggaaagactttattgtcgat
gattatcaaatttaccaagccaaagctcatggtgcagactgtattttacttatagccaac
attttgtctaaatcccagattgaagaccttacagatacagcacaccacttgggattagat
gtcttgttagaattttatagtggtgaagattttgataaatactattccaaattaaaaatg
gtaggcattaacaaccgaaacctcaatacttttgaagtggattacgagcacgccattaga
atgcgaaaccaattgcctgaagacactttaagcgttgccgaaagtgccatttatagtcct
gaaatttataaaaaactaaaaaacaatggttttgaggcttttttaatgggcgaatatttt
atgaagcaagaccatgttggagcggctttacaatcttttattgaagaaataaaataa

DBGET integrated database retrieval system